Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade

Product name Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade
Uniprot ID P17931
Source CAS: 2669063-84-5
Species Human
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Mac-2 antigen, Lectin L-29, LGALS3, Galactose-specific lectin 3, 35 kDa lectin, Galactoside-binding protein, CBP 35, L-31, Gal-3, Laminin-binding protein, Galectin-3, GALBP, IgE-binding protein, Carbohydrate-binding protein 35, MAC2
Reference PX-TA1960
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade
Uniprot ID P17931
Source CAS: 2669063-84-5
Species Human
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Mac-2 antigen, Lectin L-29, LGALS3, Galactose-specific lectin 3, 35 kDa lectin, Galactoside-binding protein, CBP 35, L-31, Gal-3, Laminin-binding protein, Galectin-3, GALBP, IgE-binding protein, Carbohydrate-binding protein 35, MAC2
Reference PX-TA1960
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1960-50
Uniprot ID P17931
Source CAS: 2669063-84-5
Species Human
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Mac-2 antigen, Lectin L-29, LGALS3, Galactose-specific lectin 3, 35 kDa lectin, Galactoside-binding protein, CBP 35, L-31, Gal-3, Laminin-binding protein, Galectin-3, GALBP, IgE-binding protein, Carbohydrate-binding protein 35, MAC2
Reference PX-TA1960
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Oloctinebart Biosimilar is a research grade monoclonal antibody (mAb) that targets the Mac-2 antigen. This highly specific and potent antibody has shown promising results in pre-clinical studies and is being developed as a potential therapeutic for various diseases. In this article, we will explore the structure, activity, and potential applications of Oloctinebart Biosimilar.

Structure of Oloctinebart Biosimilar

Oloctinebart Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of the antibody is responsible for binding to the Mac-2 antigen, while the constant region is responsible for effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Oloctinebart Biosimilar

Oloctinebart Biosimilar specifically targets the Mac-2 antigen, which is a glycoprotein expressed on the surface of various cell types, including cancer cells and activated immune cells. The binding of Oloctinebart Biosimilar to the Mac-2 antigen results in the inhibition of its activity, leading to a decrease in cell proliferation, migration, and invasion. This makes Oloctinebart Biosimilar a potential therapeutic for diseases that involve abnormal cell growth and migration, such as cancer.

In addition, Oloctinebart Biosimilar can also activate the immune system through its effector functions. Upon binding to the Mac-2 antigen on the surface of target cells, Oloctinebart Biosimilar can recruit immune cells and trigger their cytotoxic activity, resulting in the destruction of target cells. This mechanism of action makes Oloctinebart Biosimilar a potential therapeutic for diseases that involve immune dysfunction, such as autoimmune disorders.

Potential Applications of Oloctinebart Biosimilar

Oloctinebart Biosimilar has shown promising results in pre-clinical studies for various diseases, including cancer, autoimmune disorders, and inflammatory diseases. In cancer, Oloctinebart Biosimilar has been shown to inhibit the growth and metastasis of various types of cancer cells, including breast, lung, and colon cancer. It has also been shown to sensitize cancer cells to chemotherapy and radiation therapy, making it a potential combination therapy for cancer treatment.

In autoimmune disorders, Oloctinebart Biosimilar has been shown to inhibit the activity of immune cells and reduce inflammation. This makes it a potential therapeutic for diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis.

In inflammatory diseases, Oloctinebart Biosimilar has been shown to reduce the production of pro-inflammatory cytokines and inhibit the migration of immune cells to the site of inflammation. This makes it a potential therapeutic for diseases such as asthma, inflammatory bowel disease, and psoriasis.

Conclusion

In summary, Oloctinebart Biosimilar is a research grade monoclonal antibody that specifically targets the Mac-2 antigen. Its structure, activity, and potential applications make it a promising therapeutic for various diseases. Further research and clinical trials are needed to fully understand the potential of Oloctinebart Biosimilar and its role in the treatment of diseases.

SDS-PAGE for Research Grade Oloctinebart

SDS-PAGE for Research Grade Oloctinebart

Research Grade Oloctinebart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade

There are no reviews yet.

Be the first to review “Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products