Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Theralizumab Biosimilar – Anti-CD28 mAb – Research Grade

Isotype:
IgG4

Original price was: $129.00.Current price is: $100.00.

50ug 22% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Product name PX-TA1927-50
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Clonality Monoclonal Antibody
Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Clonality Monoclonal Antibody

Introduction

Theralizumab Biosimilar, also known as Anti-CD28 mAb, is a monoclonal antibody that targets the CD28 protein on the surface of T cells. This biosimilar is a highly specific and potent therapeutic agent that has shown promising results in various pre-clinical and clinical studies. In this article, we will discuss the structure, activity, and potential applications of Theralizumab Biosimilar.

Structure of Theralizumab Biosimilar

Theralizumab Biosimilar is a recombinant humanized IgG4 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the CD28 protein, while the constant region determines the effector functions of the antibody.

The amino acid sequence of Theralizumab Biosimilar is highly similar to the reference product, making it a biosimilar rather than a generic drug. This means that it has comparable structural and functional properties to the reference product, and has undergone rigorous testing to ensure its similarity.

Activity of Theralizumab Biosimilar

Theralizumab Biosimilar works by binding to the CD28 protein on the surface of T cells. CD28 is a co-stimulatory molecule that is essential for T cell activation and proliferation. By targeting CD28, Theralizumab Biosimilar can modulate T cell responses and regulate immune function.

Studies have shown that Theralizumab Biosimilar can block the interaction between CD28 and its ligands, CD80 and CD86, thereby inhibiting T cell activation. This can be beneficial in conditions where excessive T cell activation is involved, such as autoimmune diseases and organ transplant rejection.

In addition, Theralizumab Biosimilar has also been shown to induce regulatory T cells, which can suppress immune responses and promote immune tolerance. This mechanism of action has potential applications in autoimmune diseases, allergies, and transplant rejection.

Potential Applications of Theralizumab Biosimilar

Theralizumab Biosimilar has shown promising results in various pre-clinical and clinical studies, and has the potential to be used in a wide range of therapeutic applications. Some of the potential applications of Theralizumab Biosimilar include:

Autoimmune Diseases Theralizumab Biosimilar has shown efficacy in treating autoimmune diseases such as rheumatoid arthritis, psoriasis, and multiple sclerosis. By modulating T cell responses, it can help reduce inflammation and symptoms in these conditions.

Organ Transplant Rejection

Theralizumab Biosimilar has the potential to be used as an immunosuppressive agent in organ transplant patients. By inhibiting T cell activation, it can prevent rejection of the transplanted organ without compromising the overall immune function.

Allergies

Theralizumab Biosimilar has been shown to be effective in reducing allergic responses, such as asthma and allergic rhinitis. By inducing regulatory T cells, it can suppress the overactive immune response responsible for these conditions.

Cancer

Theralizumab Biosimilar has also been investigated as a potential treatment for cancer. By targeting the CD28 protein, it can enhance the anti-tumor immune response and potentially improve the efficacy of other cancer therapies.

Conclusion

In summary, Theralizumab Biosimilar is a highly specific and potent monoclonal antibody that targets the CD28 protein on T cells. Its unique mechanism of action has potential applications in various diseases, including autoimmune diseases, organ transplant rejection, allergies, and cancer. With further research and development, Theralizumab Bios

SDS-PAGE for Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

SDS-PAGE for Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

There are no reviews yet.

Be the first to review “Theralizumab Biosimilar – Anti-CD28 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products