Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD28 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P10747
Molecular weight:
42.63KDa

$500.00

100ug + 500 loyalty points
Met1~Pro152 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD28 Recombinant Protein

Product name CD28 Recombinant Protein
Uniprot ID P10747
Uniprot link http://www.uniprot.org/uniprot/P10747
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Molecular weight 42.63KDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Pro152
Aliases /Synonyms /
Reference PX-P4080
Note For research use only
Background information Array
Molecular Constructor
Met1~Pro152 Fc

General information on CD28 Recombinant Protein:

CD28 (Cluster of Differentiation 28) belongs to the immunoglobulin (Ig) superfamily. It is a glycoprotein linked to dyslipidemia. It is structurally composed of a single Ig V-like extracellular domain, transmembrane domain and intracellular domain. Mouse CD28 is structurally expressed on the surface of all parietal cells and developing thymocytes in the form of disulfide-bound homodimers or monomers. CD28 can bind B7-1 and B7-2 ligands and together play an important role in the response of T lymphocytes and B lymphocytes and tolerance of peripheral cells. Thus, CD28 is involved in the activation of T cells, the induction of cell proliferation, the production of cytokines and the acceleration of T cell survival.

There are no reviews yet.

Be the first to review “CD28 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products