Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD80 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P33681
Molecular weight:
45kDa

Original price was: $319.00.Current price is: $249.00.

100ug 22% OFF + 249 loyalty points
Met1~Asn242 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD80 Recombinant Protein

Product name PX-P4090-100
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN
Molecular weight 45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asn242
Aliases /Synonyms CD28LG, CD28LG1, LAB7
Reference PX-P4090
Note For research use only
Molecular Constructor
Met1~Asn242 His
Product name PX-P4090-1MG
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN
Molecular weight 45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asn242
Aliases /Synonyms CD28LG, CD28LG1, LAB7
Reference PX-P4090
Note For research use only
Molecular Constructor
Met1~Asn242 His
Product name PX-P4090-50
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN
Molecular weight 45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asn242
Aliases /Synonyms CD28LG, CD28LG1, LAB7
Reference PX-P4090
Note For research use only
Molecular Constructor
Met1~Asn242 His

General information on CD80 Recombinant Protein:

Cluster of Differentiation 80, also known as B7-1, is a member of the cell surface immunoglobulin superfamily. It is expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. CD80 plays a fundamental but different role in the activation of T cells. B7-1 / CD80 and B7-2 / CD86 and its CD28 and CTLA4 receptors constitute one of the main co-stimulatory pathways that regulate the response of T and B cells. CD80 is mainly expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. Although CTLA-4 and CD28 can bind to the same ligand, CTLA-4 binds B7-1 and B7-2 with an affinity 20-100 times greater than CD28 and participates in the negative regulation of immune responses. Therefore, CD80 is considered a promising therapeutic target for autoimmune diseases and various types of cancer.

CD80 Recombinant Protein

There are no reviews yet.

Be the first to review “CD80 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products