Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Inezetamab Biosimilar – Anti-CD40;MSLN mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1 Lambda; na Kappa

Original price was: $207.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Inezetamab Biosimilar - Anti-CD40;MSLN mAb - Research Grade

Product name Inezetamab Biosimilar - Anti-CD40;MSLN mAb - Research Grade
Uniprot ID P25942 & Q13421
Species Bispecific Mixed mAb and scFv
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Inezetamab,,CD40;MSLN,anti-CD40;MSLN
Reference PX-TA1849
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda; na Kappa
Clonality Monoclonal Antibody
Product name Inezetamab Biosimilar - Anti-CD40;MSLN mAb - Research Grade
Uniprot ID P25942 & Q13421
Species Bispecific Mixed mAb and scFv
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Inezetamab,,CD40;MSLN,anti-CD40;MSLN
Reference PX-TA1849
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda; na Kappa
Clonality Monoclonal Antibody
Product name PX-TA1849-50
Uniprot ID P25942 & Q13421
Species Bispecific Mixed mAb and scFv
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Inezetamab,,CD40;MSLN,anti-CD40;MSLN
Reference PX-TA1849
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda; na Kappa
Clonality Monoclonal Antibody

Introduction

Inezetamab Biosimilar, also known as Anti-CD40,MSLN mAb, is a novel monoclonal antibody that has gained attention in the field of cancer research due to its potential therapeutic applications. This biosimilar is designed to target two important proteins, CD40 and MSLN, which play crucial roles in the progression of various types of cancers. In this scientific description, we will delve into the structure, activity, and potential applications of Inezetamab Biosimilar.

Structure of Inezetamab Biosimilar

Inezetamab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in a laboratory using human genes. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region is responsible for binding to its target proteins, CD40 and MSLN, while the constant region determines the antibody’s effector functions.

Activity of Inezetamab Biosimilar

The primary target of Inezetamab Biosimilar is CD40, a cell surface protein found on immune cells such as B cells, dendritic cells, and macrophages. CD40 plays a crucial role in the activation and differentiation of these immune cells, making it an attractive therapeutic target for cancer treatment. By binding to CD40, Inezetamab Biosimilar can activate immune cells and enhance their anti-tumor activity.

In addition, Inezetamab Biosimilar also targets MSLN, a protein that is overexpressed in many types of cancers, including ovarian, lung, and pancreatic cancer. MSLN is involved in promoting tumor growth, invasion, and metastasis, making it a promising target for cancer therapy. By binding to MSLN, Inezetamab Biosimilar can inhibit its activity and potentially slow down the progression of cancer.

Potential Applications of Inezetamab Biosimilar

The dual targeting activity of Inezetamab Biosimilar makes it a promising candidate for the treatment of various types of cancers. It has shown potential in preclinical studies for the treatment of ovarian, lung, and pancreatic cancer, which are known to overexpress MSLN. Inezetamab Biosimilar has also shown promising results in combination with other cancer therapies, such as chemotherapy and immune checkpoint inhibitors.

One potential application of Inezetamab Biosimilar is in the treatment of ovarian cancer. Ovarian cancer is the fifth leading cause of cancer-related deaths in women, and current treatment options are limited. Inezetamab Biosimilar has shown promising results in preclinical studies by inhibiting MSLN and activating immune cells to target ovarian cancer cells.

Inezetamab Biosimilar also has potential applications in lung

cancer, which is the leading cause of cancer-related deaths worldwide. By targeting MSLN, Inezetamab Biosimilar can inhibit the growth and metastasis of lung cancer cells. In addition, its ability to activate immune cells can enhance the immune response against lung cancer cells.

Furthermore, Inezetamab Biosimilar has shown potential in the treatment of pancreatic cancer, one of the most aggressive and deadliest forms of cancer. By targeting MSLN, Inezetamab Biosimilar can inhibit the growth and spread of pancreatic cancer cells. Its ability to activate immune cells can also enhance the immune response against pancreatic cancer cells.

Conclusion

Inezetamab Biosimilar, also known as Anti-CD40,MSLN mAb, is a novel monoclonal antibody with dual targeting activity against CD40 and MSLN. Its unique structure and activity make it a promising candidate for the treatment of various types of cancers, including ovarian, lung, and pancreatic cancer. Further studies and clinical trials are needed to fully understand the potential of Inezetamab Biosimilar in cancer therapy. However, its promising results in preclinical studies make it a potential game-changer in the field of cancer research.

SDS-PAGE for Inezetamab Biosimilar - Anti-CD40,MSLN mAb - Research Grade

SDS-PAGE for Inezetamab Biosimilar - Anti-CD40,MSLN mAb - Research Grade

Inezetamab Biosimilar - Anti-CD40,MSLN mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Inezetamab Biosimilar - Anti-CD40;MSLN mAb - Research Grade

There are no reviews yet.

Be the first to review “Inezetamab Biosimilar – Anti-CD40;MSLN mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

  • Letolizumab Biosimilar - Anti-CD40LG, CD154 mAb binds to CD40 ligand(CD40LG) in indirect ELISA Assay
    Original price was: $246.00.Current price is: $217.00.
    View Product

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products