Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sirukumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Sirukumab ELISA Kit

Sirukumab ELISA Kit

Product name Sirukumab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX151
Note For research use only.
Sample type Plasma, Serum
Target Sirukumab
Immunogen Sirukumab

Introduction

Sirukumab is a fully human monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various autoimmune and inflammatory diseases. The Sirukumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Sirukumab in various biological samples. In this article, we will provide a detailed description of the structure, activity, and application of the Sirukumab ELISA Kit.

Structure of Sirukumab

Sirukumab is a recombinant human IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of Sirukumab is responsible for binding to its target, IL-6, while the constant region determines its effector functions. The antibody is produced using recombinant DNA technology in a mammalian cell expression system, ensuring its human origin and reducing the risk of immunogenicity.

Activity of Sirukumab

Sirukumab binds specifically to IL-6 with high affinity, preventing its interaction with its receptor and subsequent signaling. This results in the inhibition of IL-6-mediated inflammatory responses. IL-6 is a key mediator of the acute phase response and plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases, such as rheumatoid arthritis, psoriasis, and systemic lupus erythematosus. By blocking IL-6, Sirukumab effectively reduces inflammation and provides therapeutic benefits in these diseases.

Application of Sirukumab ELISA Kit

The Sirukumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Sirukumab in various biological samples, such as serum, plasma, and cell culture supernatant. It is a solid-phase enzyme-linked immunosorbent assay (ELISA) that utilizes a two-site sandwich format. The kit includes pre-coated plates, standards, controls, and all necessary reagents for the detection of Sirukumab. The assay procedure involves the addition of samples and standards to the pre-coated plates, followed by the addition of a biotinylated detection antibody and an enzyme-conjugated streptavidin. The amount of Sirukumab present in the sample is then determined by measuring the absorbance at a specific wavelength.

The Sirukumab ELISA Kit has a wide dynamic range and a low limit of detection, making it suitable for the measurement of Sirukumab in both clinical and research settings. It has been validated for accuracy, precision, and specificity, ensuring reliable and reproducible results. The kit can be used to monitor Sirukumab levels in patients receiving treatment with this antibody, as well as in preclinical studies to assess its pharmacokinetics and pharmacodynamics.

Conclusion

In conclusion, the Sirukumab ELISA Kit is a valuable tool for the detection and quantification of Sirukumab, a fully human monoclonal antibody that specifically targets IL-6. Its high sensitivity and specificity make it suitable for various applications, including clinical monitoring and preclinical studies. The use of this kit in research and clinical settings will aid in the understanding of the mechanism of action and therapeutic potential of Sirukumab in various autoimmune and inflammatory diseases.

Sirukumab ELISA Kit

There are no reviews yet.

Be the first to review “Sirukumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products