Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ziltivekimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ziltivekimab ELISA Kit

Ziltivekimab ELISA Kit

Product name Ziltivekimab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX152
Note For research use only.
Sample type Plasma, Serum
Target Ziltivekimab
Immunogen Ziltivekimab

Introduction to Ziltivekimab ELISA Kit

Ziltivekimab, also known as ABT-719, is a monoclonal antibody that targets the interleukin-33 (IL-33) cytokine. It is currently being developed as a potential therapeutic for inflammatory diseases such as asthma, atopic dermatitis, and chronic obstructive pulmonary disease (COPD). The Ziltivekimab ELISA Kit is a specialized tool used for the detection and quantification of Ziltivekimab in biological samples. In this article, we will discuss the structure, activity, and applications of this ELISA kit.

Structure of Ziltivekimab

Ziltivekimab is a fully human IgG1 monoclonal antibody, meaning it is derived from human cells and has a specific subtype of antibody constant region. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the target IL-33 cytokine.

The Ziltivekimab ELISA Kit utilizes a sandwich immunoassay format, where the antibody is coated onto the surface of a microplate. The sample containing Ziltivekimab is added to the plate, and any Ziltivekimab present will bind to the coated antibody. A second antibody, labeled with an enzyme such as horseradish peroxidase, is then added to detect the bound Ziltivekimab. The enzyme will produce a color change in the presence of a substrate, allowing for the quantification of Ziltivekimab in the sample.

Activity of Ziltivekimab

Ziltivekimab specifically targets IL-33, a pro-inflammatory cytokine that is involved in various inflammatory diseases. IL-33 is produced by damaged or stressed cells and acts as an alarm signal to the immune system, leading to the recruitment and activation of immune cells. In chronic inflammatory diseases, such as asthma and atopic dermatitis, IL-33 is overproduced, leading to excessive inflammation and tissue damage.

By binding to IL-33, Ziltivekimab prevents it from binding to its receptor and initiating the inflammatory response. This activity has been demonstrated in preclinical studies, where Ziltivekimab has shown efficacy in reducing inflammation and improving disease symptoms in animal models of asthma and atopic dermatitis.

Applications of Ziltivekimab ELISA Kit

The Ziltivekimab ELISA Kit has various applications in the development and evaluation of Ziltivekimab as a potential therapeutic. In preclinical studies, the ELISA Kit can be used to measure the levels of Ziltivekimab in biological samples, such as blood or tissue, to assess its pharmacokinetics (how the body processes the drug) and pharmacodynamics (how the drug affects the body).

In clinical trials, the ELISA Kit can be used to monitor the levels of Ziltivekimab in patient samples to ensure proper dosing and evaluate the drug’s efficacy. It can also be used to detect the presence of anti-drug antibodies (ADAs), which can affect the drug’s effectiveness and safety.

Furthermore, the Ziltivekimab ELISA Kit can be used in quality control during the manufacturing process of Ziltivekimab to ensure consistent and accurate levels of the drug are being produced.

Conclusion

In summary, the Ziltivekimab ELISA Kit is a valuable tool for the detection and quantification of Ziltivekimab in biological samples. Its structure as a fully human IgG1 monoclonal antibody and its activity in targeting IL-33 make it a promising therapeutic for inflammatory diseases. The ELISA Kit has various applications in the development and evaluation of Ziltivekimab, making it an essential tool in the research and development of this potential treatment option.

Ziltivekimab ELISA Kit

There are no reviews yet.

Be the first to review “Ziltivekimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products