Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ziltivekimab Biosimilar – Anti-IL6 mAb – Research Grade

  • PX-TA1613-100UG
  • 1 review
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $293.00.Current price is: $238.00.

100ug 19% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade

Product name Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 2226654-05-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ziltivekimab ,COR-001,IL6 ,anti-IL6
Reference PX-TA1613
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 2226654-05-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ziltivekimab ,COR-001,IL6 ,anti-IL6
Reference PX-TA1613
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1613-50
Uniprot ID P05231
Source CAS 2226654-05-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ziltivekimab ,COR-001,IL6 ,anti-IL6
Reference PX-TA1613
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Ziltivekimab Biosimilar: A Promising Anti-IL6 mAb for Therapeutic Targeting Introduction

Ziltivekimab Biosimilar, also known as Anti-IL6 mAb, is a promising therapeutic antibody that targets the cytokine Interleukin-6 (IL-6). IL-6 is a pro-inflammatory cytokine that plays a crucial role in various diseases, making it an attractive therapeutic target. Ziltivekimab Biosimilar is a research grade antibody that has shown potential in pre-clinical studies for the treatment of multiple diseases. In this article, we will explore the structure, activity, and potential applications of Ziltivekimab Biosimilar.

Structure of Ziltivekimab Biosimilar

Ziltivekimab Biosimilar is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is a biosimilar of the anti-IL6 mAb Tocilizumab, which is currently used for the treatment of rheumatoid arthritis and other inflammatory diseases. Ziltivekimab Biosimilar has a similar structure to Tocilizumab, with a molecular weight of approximately 148 kDa. It is composed of two heavy chains and two light chains, with each chain containing a variable region and a constant region. The variable regions are responsible for binding to IL-6, while the constant regions determine the antibody’s effector functions.

Activity of Ziltivekimab Biosimilar

Ziltivekimab Biosimilar binds to IL-6 with high affinity, preventing it from binding to its receptors and activating downstream signaling pathways. IL-6 signaling is involved in the regulation of immune responses, inflammation, and tissue regeneration. However, dysregulation of IL-6 signaling has been linked to the pathogenesis of various diseases, including rheumatoid arthritis, inflammatory bowel disease, and cytokine release syndrome. By blocking IL-6 signaling, Ziltivekimab Biosimilar can reduce inflammation and improve disease outcomes.

Potential Applications of Ziltivekimab Biosimilar

Ziltivekimab Biosimilar has shown promising results in pre-clinical studies for the treatment of various diseases. In a mouse model of rheumatoid arthritis, Ziltivekimab Biosimilar was able to reduce joint inflammation and prevent cartilage destruction. It has also shown potential in the treatment of inflammatory bowel disease, with studies demonstrating a reduction in disease severity and improved intestinal barrier function. Additionally, Ziltivekimab Biosimilar has been studied in the context of cytokine release syndrome, a potentially life-threatening complication of certain cancer treatments. It has been shown to effectively block IL-6 signaling and reduce cytokine levels, suggesting its potential as a treatment for this condition.

Conclusion

In summary, Ziltivekimab Biosimilar is a promising anti-IL6 mAb with potential applications in the treatment of various diseases. Its structure and activity make it a strong candidate for targeting IL-6, a key cytokine involved in the pathogenesis of many inflammatory conditions. With further research and clinical trials, Ziltivekimab Biosimilar has the potential to become a valuable therapeutic option for patients in need of IL-6 blockade.

SDS-PAGE for Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade

SDS-PAGE for Ziltivekimab  Biosimilar - Anti-IL6  mAb - Research Grade

Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in ELISA Assay

Ziltivekimab  Biosimilar - Anti-IL6  mAb - Research Grade binds to IL6, C-His, recombinant protein in ELISA Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) at 0.5µg/mL (100µL/well) can bind Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Ziltivekimab  Biosimilar - Anti-IL6  mAb - Research Grade

  • Stefano Ministrini — April 15, 2022

    I used this antibody for in vivo blockade of IL-6. It worked as expected and I got interesting results.

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products