Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vanucizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Vanucizumab ELISA Kit

Vanucizumab ELISA Kit

Product name Vanucizumab ELISA Kit
Uniprot ID P15692 & O15123
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX118
Note For research use only.
Sample type Plasma, Serum
Target Vanucizumab
Immunogen Vanucizumab

The Structure of Vanucizumab ELISA Kit

Vanucizumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) kit designed for the quantitative detection of Vanucizumab in biological samples. Vanucizumab, also known as RO5509554, is a novel bispecific antibody that targets both vascular endothelial growth factor (VEGF) and angiopoietin-2 (Ang-2). This unique structure allows Vanucizumab to simultaneously inhibit two key pathways involved in tumor angiogenesis and vascular permeability, making it a promising therapeutic target for various types of cancer.

The Vanucizumab ELISA Kit is composed of several components including a microplate coated with a monoclonal antibody specific to Vanucizumab, a conjugate solution containing a horseradish peroxidase (HRP)-labeled detection antibody, a substrate solution, and a stop solution. The microplate is pre-coated with a capture antibody that specifically binds to Vanucizumab, allowing for the specific detection of the antibody in biological samples.

The Activity of Vanucizumab ELISA Kit

The Vanucizumab ELISA Kit utilizes a competitive ELISA format, where the amount of Vanucizumab present in the sample is inversely proportional to the amount of HRP-labeled detection antibody bound to the capture antibody on the microplate. In other words, the more Vanucizumab present in the sample, the less HRP-labeled detection antibody will bind and the lower the signal will be.

The activity of the Vanucizumab ELISA Kit is based on the principle of antigen-antibody binding, where the specific binding of Vanucizumab to the capture antibody on the microplate is detected through the use of an HRP-labeled detection antibody. Upon addition of the substrate solution, the HRP enzyme catalyzes a colorimetric reaction, resulting in a change in color that is directly proportional to the amount of Vanucizumab present in the sample. The absorbance of the colored solution can then be measured using a spectrophotometer, providing a quantitative measurement of Vanucizumab levels in the sample.

The Application of Vanucizumab ELISA Kit

The Vanucizumab ELISA Kit has a wide range of applications in both research and clinical settings. In research, it can be used to measure the levels of Vanucizumab in biological samples such as serum, plasma, and cell culture supernatants. This allows for the monitoring of Vanucizumab levels in preclinical and clinical studies, providing valuable insights into the pharmacokinetics and pharmacodynamics of the antibody.

In the clinical setting, the Vanucizumab ELISA Kit can be used for patient monitoring and disease management. Elevated levels of Vanucizumab have been associated with various types of cancer, including colorectal, ovarian, and lung cancer. Therefore, the Vanucizumab ELISA Kit can be used to measure the response to Vanucizumab therapy and to monitor disease progression in these patients.

In addition, the Vanucizumab ELISA Kit can also be used for the development and optimization of Vanucizumab-based therapies. By accurately quantifying Vanucizumab levels in biological samples, researchers can determine the optimal dose and dosing schedule for treatment, leading to improved therapeutic outcomes.

In conclusion, the Vanucizumab ELISA Kit is a highly sensitive and specific tool for the quantitative detection of Vanucizumab in biological samples. Its unique structure, activity, and wide range of applications make it an essential tool for researchers and clinicians studying the role of Vanucizumab in cancer and developing novel therapies targeting this important therapeutic target.

Vanucizumab ELISA Kit

There are no reviews yet.

Be the first to review “Vanucizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products