Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vanucizumab Biosimilar – Anti-ANGPT2, VEGFA, mAb – Research Grade

  • PX-TA1355-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa

Original price was: $213.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb - Research Grade

Product name Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1448221-05-3
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vanucizumab,RG-7221,RG7221,RO5520985,ANGPT2, VEGFA, ,anti-ANGPT2, VEGFA,
Reference PX-TA1355
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa
Clonality Monoclonal Antibody
Product name Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1448221-05-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vanucizumab,RG-7221,RG7221,RO5520985,ANGPT2, VEGFA, ,anti-ANGPT2, VEGFA,
Reference PX-TA1355
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa
Clonality Monoclonal Antibody
Product name PX-TA1355-50
Uniprot ID P15692 & O15123
Source CAS 1448221-05-3
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vanucizumab,RG-7221,RG7221,RO5520985,ANGPT2, VEGFA, ,anti-ANGPT2, VEGFA,
Reference PX-TA1355
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa
Clonality Monoclonal Antibody

General information on Anti-ANGPT2/VEGFA[Homo sapiens], (Vanucizumab) Monoclonal Antibody

Vanucizumab has been investigated for the treatment of Colorectal Cancer and Advanced/Metastatic Solid Tumors.

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb (cat. No.PX-TA1355) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 105.6M.

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA,  mAb - Research Grade

There are no reviews yet.

Be the first to review “Vanucizumab Biosimilar – Anti-ANGPT2, VEGFA, mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products