Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Immunoglobulin G-binding protein G(spg) His Tag

Host species:
Escherichia coli (E.coli)
Origin species:
Streptococcus sp. group G
Uniprot ID:
P19909
Molecular weight:
21.24kDa

Original price was: $218.00.Current price is: $169.00.

100ug 22% OFF + 169 loyalty points
Lys314–Glu497 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Immunoglobulin G-binding protein G(spg) His Tag

Product name Immunoglobulin G-binding protein G(spg) His Tag
Uniprot ID P19909
Uniprot link https://www.uniprot.org/uniprot/P19909
Origin species Streptococcus sp. group G
Expression system Prokaryotic expression
Raw Antigen Sequence KGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Molecular weight 21.24kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys314-Glu497
Protein Accession P19909
NCBI Reference P19909
Aliases /Synonyms IgG-binding protein G
Reference PX-P4645
Note For research use only
Molecular Constructor
Lys314–Glu497 His
Product name Immunoglobulin G-binding protein G(spg) His Tag
Uniprot ID P19909
Uniprot link https://www.uniprot.org/uniprot/P19909
Origin species Streptococcus sp. group G
Expression system Prokaryotic expression
Raw Antigen Sequence KGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Molecular weight 21.24kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys314-Glu497
Protein Accession P19909
NCBI Reference P19909
Aliases /Synonyms IgG-binding protein G
Reference PX-P4645
Note For research use only
Molecular Constructor
Lys314–Glu497 His
Product name PX-P4645-1MG
Uniprot ID P19909
Uniprot link https://www.uniprot.org/uniprot/P19909
Origin species Streptococcus sp. group G
Expression system Prokaryotic expression
Raw Antigen Sequence KGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Molecular weight 21.24kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys314-Glu497
Protein Accession P19909
NCBI Reference P19909
Aliases /Synonyms IgG-binding protein G
Reference PX-P4645
Note For research use only
Molecular Constructor
Lys314–Glu497 His

Immunoglobulin G-binding protein G(spg) His Tag

There are no reviews yet.

Be the first to review “Immunoglobulin G-binding protein G(spg) His Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products