Name: Immunoglobulin G-binding protein G(spg) His Tag
SKU: PX-P4645-10
Availability: InStock

Product name	Immunoglobulin G-binding protein G(spg) His Tag
Uniprot ID	P19909
Uniprot link	https://www.uniprot.org/uniprot/P19909
Origin species	Streptococcus sp. group G
Expression system	Prokaryotic expression
Sequence	MGKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEHHHHHH
Molecular weight	21.24kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Lys314-Glu497
Protein Accession	P19909
NCBI Reference	P19909
Aliases /Synonyms	IgG-binding protein G
Reference	PX-P4645
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Immunoglobulin G-binding protein G(spg) His Tag”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1100 476$

View product

Tag Antibody

PTX17851 189$

View product