Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Synthetic construction GST 26-1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
synthetic construction
Uniprot ID:
P08515
Molecular weight:
39.38kDa

$250.00

50ug + 250 loyalty points
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Synthetic construction GST 26-1 Recombinant Protein

Product name Synthetic construction GST 26-1 Recombinant Protein
Uniprot ID P08515
Uniprot link https://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MATQHIVGDDKGWALGVDYVAWANARQIVQGDELVFNYDVKGDFPVFYTTKDKFERCCPYGALMELANTGHNVVTLGGVGDYYFIPKGVDCKQNMKLHVNVKASPALQEGRNAILAGSLEVLFQGPHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
Molecular weight 39.38kDa
Purity estimated 70%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID P08515
NCBI Reference ABS19453
Aliases /Synonyms GST 26-1 (Sta1)
Reference PX-P2092
Note For research use only
Product name Synthetic construction GST 26-1 Recombinant Protein
Uniprot ID P08515
Uniprot link https://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MATQHIVGDDKGWALGVDYVAWANARQIVQGDELVFNYDVKGDFPVFYTTKDKFERCCPYGALMELANTGHNVVTLGGVGDYYFIPKGVDCKQNMKLHVNVKASPALQEGRNAILAGSLEVLFQGPHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
Molecular weight 39.38kDa
Purity estimated 70%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID P08515
NCBI Reference ABS19453
Aliases /Synonyms GST 26-1 (Sta1)
Reference PX-P2092
Note For research use only

There are no reviews yet.

Be the first to review “Synthetic construction GST 26-1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products