Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

IGFBP1 protein – Human IGFBP1 full length Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08833
Molecular weight:
28.74kDa

$250.00

50ug + 250 loyalty points
Full-length Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

IGFBP1 protein - Human IGFBP1 full length Recombinant Protein

Product name IGFBP1 protein - Human IGFBP1 full length Recombinant Protein
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF
Molecular weight 28.74kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5%
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2077
Note For research use only
Molecular Constructor
Full-length Yes
Product name IGFBP1 protein - Human IGFBP1 full length Recombinant Protein
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF
Molecular weight 28.74kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5%
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2077
Note For research use only
Molecular Constructor
Full-length Yes

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing

There are no reviews yet.

Be the first to review “IGFBP1 protein – Human IGFBP1 full length Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products