Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IGFBP1 Nter Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08833
Molecular weight:
17.59 kD

Original price was: $549.00.Current price is: $472.00.

100ug 14% OFF + 472 loyalty points
Partial
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human IGFBP1 Nter Recombinant Protein

Product name Human IGFBP1 Nter Recombinant Protein
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight 17.59 kD
Purity estimated 85%
Buffer PBS, pH 7.5 with 0.2mM β-Met
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2078
Note For research use only
Molecular Constructor
Partial
Product name Human IGFBP1 Nter Recombinant Protein
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight 17.59 kD
Purity estimated 85%
Buffer PBS, pH 7.5 with 0.2mM β-Met
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2078
Note For research use only
Molecular Constructor
Partial
Product name PX-P2078-1MG
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight 17.59 kD
Purity estimated 85%
Buffer PBS, pH 7.5 with 0.2mM β-Met
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2078
Note For research use only
Molecular Constructor
Partial

Human IGFBP1 Nter Recombinant Protein

There are no reviews yet.

Be the first to review “Human IGFBP1 Nter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products