Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MOR106 Biosimilar – Anti-Cytokine CX2 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade

Product name MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade
Uniprot ID Q9P0M4
Species Mouse
Raw Antigen Sequence MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Cytokine CX2,IL17C,IL-17C,Interleukin-17C,
Reference PX-TA1904
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade
Uniprot ID Q9P0M4
Species Mouse
Raw Antigen Sequence MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Cytokine CX2,IL17C,IL-17C,Interleukin-17C,
Reference PX-TA1904
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1904-50
Uniprot ID Q9P0M4
Species Mouse
Raw Antigen Sequence MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Cytokine CX2,IL17C,IL-17C,Interleukin-17C,
Reference PX-TA1904
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

MOR106 Biosimilar: An Overview

MOR106 Biosimilar is a novel therapeutic antibody that targets the cytokine CX2, also known as interleukin-6 (IL-6). This biosimilar is a research grade version of the original MOR106 antibody, which has shown promising results in preclinical and clinical studies for the treatment of various inflammatory diseases. In this article, we will delve into the structure, activity, and potential applications of MOR106 Biosimilar.

Structure of MOR106 Biosimilar

MOR106 Biosimilar is a monoclonal antibody (mAb) that belongs to the IgG1 isotype. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the heavy and light chains are responsible for binding to the CX2 cytokine, while the constant regions provide stability and effector functions.

The amino acid sequence of MOR106 Biosimilar is highly similar to that of the original MOR106 antibody, ensuring comparable binding affinity and specificity. The biosimilar is produced using recombinant DNA technology, making it a highly pure and consistent product.

Activity of MOR106 Biosimilar

The main mechanism of action of MOR106 Biosimilar is the inhibition of CX2 signaling. CX2 is a pro-inflammatory cytokine that plays a crucial role in the development and progression of various inflammatory diseases, such as rheumatoid arthritis, psoriasis, and Crohn’s disease. By blocking the binding of CX2 to its receptor, MOR106 Biosimilar reduces the production of inflammatory mediators and dampens the immune response.

Moreover, MOR106 Biosimilar also has the potential to modulate other immune cells and pathways involved in inflammation. This includes the regulation of T cell differentiation and function, as well as the suppression of macrophage activation and migration.

Potential Applications of MOR106 Biosimilar

Due to its ability to target CX2, MOR106 Biosimilar has the potential to be used in the treatment of a wide range of inflammatory diseases. Clinical trials have shown promising results in patients with rheumatoid arthritis, with significant improvements in disease activity and symptoms.

Furthermore, MOR106 Biosimilar has also shown efficacy in preclinical models of other inflammatory conditions, such as psoriasis, inflammatory bowel disease, and multiple sclerosis. These findings suggest that MOR106 Biosimilar may have a broad therapeutic potential in various autoimmune and inflammatory disorders.

Another potential application of MOR106 Biosimilar is in combination therapy with other biologic agents. By targeting different pathways and mechanisms, this biosimilar could potentially enhance the efficacy of existing treatments and provide a more comprehensive approach to managing inflammatory diseases.

Conclusion

MOR106 Biosimilar is a promising therapeutic antibody that targets the pro-inflammatory cytokine CX2. Its highly similar structure to the original MOR106 antibody, along with its potent activity and potential applications, make it a valuable addition to the treatment options for inflammatory diseases. Further research and clinical trials are needed to fully explore the potential of this biosimilar and its role in the management of various conditions.

Keywords: MOR106 Biosimilar, antibody, CX2, interleukin-6, IL-6, monoclonal antibody, inflammation, autoimmune diseases, combination therapy

SDS-PAGE for Research Grade MOR106

SDS-PAGE for Research Grade MOR106

Research Grade MOR106, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade

There are no reviews yet.

Be the first to review “MOR106 Biosimilar – Anti-Cytokine CX2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products