Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Spesolimab Biosimilar – Anti-IL36RN mAb – Research Grade

  • PX-TA1537-100UG
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $326.00.Current price is: $238.00.

100ug 27% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

Product name Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade
Uniprot ID Q9UBH0
Source CAS 2097104-58-8
Species Humanized
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Spesolimab,BI 655130,IL36RN,anti-IL36RN
Reference PX-TA1537
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade
Uniprot ID Q9UBH0
Source CAS 2097104-58-8
Species Humanized
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Spesolimab,BI 655130,IL36RN,anti-IL36RN
Reference PX-TA1537
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1537-50
Uniprot ID Q9UBH0
Source CAS 2097104-58-8
Species Humanized
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Spesolimab,BI 655130,IL36RN,anti-IL36RN
Reference PX-TA1537
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Spesolimab Biosimilar, also known as Anti-IL36RN mAb, is a research grade monoclonal antibody that has shown promising results in the treatment of various inflammatory diseases. This article aims to provide a scientific description of the structure, activity and application of Spesolimab Biosimilar, highlighting its potential as a therapeutic target.

Structure of Spesolimab Biosimilar

Spesolimab Biosimilar is a recombinant humanized monoclonal antibody that specifically targets the interleukin-36 receptor antagonist (IL-36Ra). It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody bind to the IL-36Ra, while the constant regions provide stability and effector functions.

Activity of Spesolimab Biosimilar

The main activity of Spesolimab Biosimilar is its ability to inhibit the activity of IL-36Ra. IL-36Ra is a cytokine that plays a crucial role in the regulation of inflammatory responses. It binds to the IL-36 receptor and prevents the activation of downstream signaling pathways, leading to the suppression of pro-inflammatory cytokines. However, in certain inflammatory diseases, there is an overexpression of IL-36Ra, leading to excessive inflammation. Spesolimab Biosimilar binds to IL-36Ra and blocks its activity, thus reducing inflammation.

Application of Spesolimab Biosimilar

Spesolimab Biosimilar has shown potential for the treatment of various inflammatory diseases, including psoriasis, psoriatic arthritis, and inflammatory bowel disease. Psoriasis is a chronic autoimmune skin disease characterized by red, scaly patches on the skin. IL-36Ra has been found to be overexpressed in psoriatic skin lesions, making it a potential therapeutic target. In a phase II clinical trial, Spesolimab Biosimilar showed significant improvement in the symptoms of psoriasis, with a good safety profile.

Psoriatic arthritis is a type of arthritis that affects people with psoriasis. IL-36Ra has also been implicated in the pathogenesis of psoriatic arthritis. In a phase II clinical trial, Spesolimab Biosimilar showed promising results in reducing the symptoms of psoriatic arthritis, such as joint pain and swelling.

Inflammatory bowel disease (IBD) is a chronic inflammatory disorder of the gastrointestinal tract, including Crohn’s disease and ulcerative colitis. IL-36Ra has been found to be upregulated in the intestinal mucosa of patients with IBD. In a preclinical study, Spesolimab Biosimilar was able to reduce inflammation and improve the symptoms of IBD.

Future Directions

The potential of Spesolimab Biosimilar as a therapeutic target is not limited to the aforementioned inflammatory diseases. IL-36Ra has also been implicated in other inflammatory conditions, such as rheumatoid arthritis, systemic lupus erythematosus, and asthma. Further research is needed to explore the efficacy of Spesolimab Biosimilar in these diseases.

Conclusion

Spesolimab Biosimilar, a research grade anti-IL36RN mAb, has shown promising results in the treatment of various inflammatory diseases. Its ability to inhibit the activity of IL-36Ra makes it a potential therapeutic target for conditions such as psoriasis, psoriatic arthritis, and inflammatory bowel disease. Further research is needed to fully understand the potential of Spesolimab Biosimilar in the treatment of other inflammatory diseases.

SDS-PAGE for Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

SDS-PAGE for Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

There are no reviews yet.

Be the first to review “Spesolimab Biosimilar – Anti-IL36RN mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products