Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Urtoxazumab Biosimilar – Anti-Stx-2, SLT-II mAb – Research Grade

  • PX-TA1190-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade

Product name Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade
Uniprot ID Q07871
Source CAS 502496-16-4
Species Humanized
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Urtoxazumab,HuVTm1.1,TMA-15,Stx-2, SLT-II,anti-Stx-2, SLT-II
Reference PX-TA1190
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade
Uniprot ID Q07871
Source CAS 502496-16-4
Species Humanized
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Urtoxazumab,HuVTm1.1,TMA-15,Stx-2, SLT-II,anti-Stx-2, SLT-II
Reference PX-TA1190
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1190-50
Uniprot ID Q07871
Source CAS 502496-16-4
Species Humanized
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Urtoxazumab,HuVTm1.1,TMA-15,Stx-2, SLT-II,anti-Stx-2, SLT-II
Reference PX-TA1190
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Urtoxazumab Biosimilar, also known as Anti-Stx-2, SLT-II mAb, is a monoclonal antibody that targets the Shiga toxin-2 (Stx-2). Stx-2 is a potent toxin produced by certain strains of bacteria, including Escherichia coli (E. coli), that can cause severe gastrointestinal illness and even life-threatening complications. Urtoxazumab Biosimilar has shown promising results in preclinical studies and is currently being developed as a potential therapeutic option for Stx-2 related infections.

Structure of Urtoxazumab Biosimilar

Urtoxazumab Biosimilar is a recombinant humanized monoclonal antibody that is produced using recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the Stx-2 toxin, while the constant region is responsible for the effector functions of the antibody.

Mechanism of Action

Urtoxazumab Biosimilar works by binding to the Stx-2 toxin and preventing it from attaching to its target cells. This prevents the toxin from entering the cells and causing damage. In addition, the bound antibody also triggers the immune system to recognize and eliminate the toxin, providing an additional layer of protection.

Application of Urtoxazumab Biosimilar

Urtoxazumab Biosimilar is being developed as a potential treatment for Stx-2 related infections, such as those caused by E. coli. These infections can range from mild diarrhea to more severe conditions, such as hemolytic uremic syndrome (HUS) and thrombotic thrombocytopenic purpura (TTP). Currently, there are no specific treatments available for Stx-2 related infections, and supportive care is the mainstay of treatment. Urtoxazumab Biosimilar has the potential to be a targeted therapy that can neutralize the toxin and improve outcomes in these patients.

Research Grade Antibody

Urtoxazumab Biosimilar is currently in the preclinical stage of development and is being evaluated in animal models for its safety and efficacy. It is being produced as a research grade antibody, which means that it is not yet approved for use in humans. However, the results from these studies will provide valuable insights into the potential of Urtoxazumab Biosimilar as a therapeutic option for Stx-2 related infections.

Potential Benefits of Urtoxazumab Biosimilar

If successful in clinical trials, Urtoxazumab Biosimilar has the potential to provide a targeted and effective treatment option for Stx-2 related infections. By neutralizing the toxin and triggering the immune system, it may reduce the severity and duration of symptoms and improve outcomes for patients. In addition, it may also have a role in preventing the progression of mild infections to more severe conditions, such as HUS and TTP.

Conclusion

Urtoxazumab Biosimilar is a promising monoclonal antibody that targets the Stx-2 toxin produced by certain strains of bacteria. It is being developed as a potential treatment option for Stx-2 related infections, which currently have no specific treatments available. With its unique mechanism of action and potential benefits, Urtoxazumab Biosimilar has the potential to improve outcomes for patients with these infections. Further research and clinical trials are needed to fully evaluate its safety and efficacy, but it holds great promise as a potential therapeutic option for Stx-2 related infections.

SEC-HPLC of Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

SEC-HPLC of Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

SDS-PAGE for Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade

There are no reviews yet.

Be the first to review “Urtoxazumab Biosimilar – Anti-Stx-2, SLT-II mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products