Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Escherichia coli shiga toxin type 2/stx2B Antibody (Iv0194)

Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $545.00.Current price is: $436.00.

100ug 20% OFF + 436 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for InVivoMAb Anti-Escherichia coli shiga toxin type 2/stx2B Antibody (Iv0194)

InVivoMAb Anti-Escherichia coli shiga toxin type 2/stx2B Antibody (Iv0194)

Product name ARO-A13107-100
Uniprot ID Q07871
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Shiga toxin 2 B subunit, Shiga toxin 2B, Shiga toxin 2c subunit B, Shiga toxin 2d subunit B, Shiga toxin 2v subunit B, Shiga-like toxin II B-subunit, Shiga-like toxin type IIvhc, Stx2c protein B subunit, VT2va beta-subunit, Verocytotoxin 2d B-subunit, stx2B, stx2b, stx2c, stx2c B, stx2cB, stx2dB, stx2vB, stxB2c, subunit B, VT2va B cistron, vtx2cB, vtx2dB, Escherichia coli
Reference ARO-A13107
Clonality Monoclonal Antibody
Protein Name Shiga toxin 2 B subunit
Product name ARO-A13107-1MG
Uniprot ID Q07871
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Shiga toxin 2 B subunit, Shiga toxin 2B, Shiga toxin 2c subunit B, Shiga toxin 2d subunit B, Shiga toxin 2v subunit B, Shiga-like toxin II B-subunit, Shiga-like toxin type IIvhc, Stx2c protein B subunit, VT2va beta-subunit, Verocytotoxin 2d B-subunit, stx2B, stx2b, stx2c, stx2c B, stx2cB, stx2dB, stx2vB, stxB2c, subunit B, VT2va B cistron, vtx2cB, vtx2dB, Escherichia coli
Reference ARO-A13107
Clonality Monoclonal Antibody
Protein Name Shiga toxin 2 B subunit
Product name ARO-A13107-50
Uniprot ID Q07871
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Shiga toxin 2 B subunit, Shiga toxin 2B, Shiga toxin 2c subunit B, Shiga toxin 2d subunit B, Shiga toxin 2v subunit B, Shiga-like toxin II B-subunit, Shiga-like toxin type IIvhc, Stx2c protein B subunit, VT2va beta-subunit, Verocytotoxin 2d B-subunit, stx2B, stx2b, stx2c, stx2c B, stx2cB, stx2dB, stx2vB, stxB2c, subunit B, VT2va B cistron, vtx2cB, vtx2dB, Escherichia coli
Reference ARO-A13107
Clonality Monoclonal Antibody
Protein Name Shiga toxin 2 B subunit

SDS-PAGE for InVivoMAb Anti-Escherichia coli shiga toxin type 2/stx2B Antibody (Iv0194)

SDS-PAGE for InVivoMAb Anti-Escherichia coli shiga toxin type 2/stx2B Antibody (Iv0194)

InVivoMAb Anti-Escherichia coli shiga toxin type 2/stx2B Antibody (Iv0194), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Escherichia coli shiga toxin type 2/stx2B Antibody (Iv0194)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products