Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human IL36RN/IL-1F5 (Iv0035)

Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $384.00.Current price is: $305.00.

50ug 21% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human IL36RN/IL-1F5 (Iv0035)

Product name ARO-A13344-100
Uniprot ID Q9UBH0
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FIL1D, Interleukin-1 family member 5, IL-36Ra, IL1HY1, Interleukin-36 receptor antagonist protein, IL1RP3, IL-1RP3, IL-1ra homolog 1, Interleukin-1-like protein 1, IL-1-related protein 3, IL1L1, Interleukin-1 HY1, IL-1HY1, Interleukin-1 delta, FIL1 delta, IL-1 delta, IL-1L1, Interleukin-1 receptor antagonist homolog 1, IL36RN, IL1F5, IL-1F5
Reference ARO-A13344
Clonality Monoclonal Antibody
Protein Name FIL1D
Product name ARO-A13344-1MG
Uniprot ID Q9UBH0
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FIL1D, Interleukin-1 family member 5, IL-36Ra, IL1HY1, Interleukin-36 receptor antagonist protein, IL1RP3, IL-1RP3, IL-1ra homolog 1, Interleukin-1-like protein 1, IL-1-related protein 3, IL1L1, Interleukin-1 HY1, IL-1HY1, Interleukin-1 delta, FIL1 delta, IL-1 delta, IL-1L1, Interleukin-1 receptor antagonist homolog 1, IL36RN, IL1F5, IL-1F5
Reference ARO-A13344
Clonality Monoclonal Antibody
Protein Name FIL1D
Product name ARO-A13344-50
Uniprot ID Q9UBH0
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FIL1D, Interleukin-1 family member 5, IL-36Ra, IL1HY1, Interleukin-36 receptor antagonist protein, IL1RP3, IL-1RP3, IL-1ra homolog 1, Interleukin-1-like protein 1, IL-1-related protein 3, IL1L1, Interleukin-1 HY1, IL-1HY1, Interleukin-1 delta, FIL1 delta, IL-1 delta, IL-1L1, Interleukin-1 receptor antagonist homolog 1, IL36RN, IL1F5, IL-1F5
Reference ARO-A13344
Clonality Monoclonal Antibody
Protein Name FIL1D

SDS-PAGE for InVivoMAb Anti-Human IL36RN/IL-1F5 (Iv0035)

SDS-PAGE for InVivoMAb Anti-Human IL36RN/IL-1F5 (Iv0035)

InVivoMAb Anti-Human IL36RN/IL-1F5 (Iv0035), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IL36RN/IL-1F5 (Iv0035)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products