Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse IL36RN/IL-1F5/IL-36Ra Polyclonal Antibody

  • ARO-A12791-100
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $274.00.Current price is: $201.00.

100ug 27% OFF + 201 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Mouse IL36RN/IL-1F5/IL-36Ra Polyclonal Antibody binds to IL36RN, N-His, recombinant protein in WB Assay

Anti-Mouse IL36RN/IL-1F5/IL-36Ra Polyclonal Antibody

Product name ARO-A12791-100
Uniprot ID Q9QYY1
Raw Antigen Sequence MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-FIL1D, Interleukin-1 family member 5, IL-36Ra, IL1HY1, Interleukin-36 receptor antagonist protein, IL1RP3, IL-1RP3, IL-1ra homolog 1, Interleukin-1-like protein 1, IL-1-related protein 3, IL1L1, Interleukin-1 HY1, IL-1HY1, Interleukin-1 delta, FIL1 delta, IL-1 delta, IL-1L1, Interleukin-1 receptor antagonist homolog 1, IL36RN, IL1F5, IL-1F5,
Reference ARO-A12791
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse IL36RN/IL-1F5/IL-36Ra (Met1-Asp156).
Product name ARO-A12791-1MG
Uniprot ID Q9QYY1
Raw Antigen Sequence MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-FIL1D, Interleukin-1 family member 5, IL-36Ra, IL1HY1, Interleukin-36 receptor antagonist protein, IL1RP3, IL-1RP3, IL-1ra homolog 1, Interleukin-1-like protein 1, IL-1-related protein 3, IL1L1, Interleukin-1 HY1, IL-1HY1, Interleukin-1 delta, FIL1 delta, IL-1 delta, IL-1L1, Interleukin-1 receptor antagonist homolog 1, IL36RN, IL1F5, IL-1F5,
Reference ARO-A12791
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse IL36RN/IL-1F5/IL-36Ra (Met1-Asp156).
Product name ARO-A12791-50
Uniprot ID Q9QYY1
Raw Antigen Sequence MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-FIL1D, Interleukin-1 family member 5, IL-36Ra, IL1HY1, Interleukin-36 receptor antagonist protein, IL1RP3, IL-1RP3, IL-1ra homolog 1, Interleukin-1-like protein 1, IL-1-related protein 3, IL1L1, Interleukin-1 HY1, IL-1HY1, Interleukin-1 delta, FIL1 delta, IL-1 delta, IL-1L1, Interleukin-1 receptor antagonist homolog 1, IL36RN, IL1F5, IL-1F5,
Reference ARO-A12791
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse IL36RN/IL-1F5/IL-36Ra (Met1-Asp156).

Anti-Mouse IL36RN/IL-1F5/IL-36Ra Polyclonal Antibody binds to IL36RN, N-His, recombinant protein in WB Assay

Anti-Mouse IL36RN/IL-1F5/IL-36Ra Polyclonal Antibody binds to IL36RN, N-His, recombinant protein in WB Assay

IL36RN, N-His, recombinant protein(cat. No.PX-P5792) can bind Anti-Mouse IL36RN/IL-1F5/IL-36Ra Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Mouse IL36RN/IL-1F5/IL-36Ra Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products