Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Caspase-1(CASP1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P29466
Molecular weight:
19.85 kDa

Original price was: $1,373.00.Current price is: $1,135.00.

1MG 17% OFF + 1135 loyalty points
Asn120–Asp297
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Caspase-1(CASP1)

Product name PX-P4722-1MG
Uniprot ID P29466
Uniprot link https://www.uniprot.org/uniprot/P29466
Expression system Prokaryotic expression
Raw Antigen Sequence NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Molecular weight 19.85 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn120-Asp297
Aliases /Synonyms CASP-1,Interleukin-1 beta convertase,IL-1BC,Interleukin-1 beta-converting enzyme,ICE,IL-1 beta-converting enzyme,p45,IL1BC, IL1BCE
Reference PX-P4722
Note For research use only
Molecular Constructor
Asn120–Asp297

SDS-PAGE for Caspase-1(CASP1)

SDS-PAGE for Caspase-1(CASP1)

Caspase-1(CASP1), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Caspase-1(CASP1)

There are no reviews yet.

Be the first to review “Caspase-1(CASP1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products