Brand: ProteoGenix

Glycine oxidase (thiO) (3-369)

PX-P4364-10

Host species:: Escherichia coli (E.coli)
Uniprot ID:: S5FMM4 (98,4%)
Molecular weight:: 67.01kDa

$250.00

+ 250 loyalty points

Lys3–Arg369

size size

50ug $250.00
100ug $469.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Glycine oxidase (thiO) (3-369)

Product name	Glycine oxidase (thiO) (3-369)
Uniprot ID	S5FMM4 (98,4%)
Expression system	Prokaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMRKRYDTIVIGGGIIGTSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLSAHRECDKPGTFFEFARASQKAYKRLTGELRDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYTPVLSIESEAGAVRVTSASGTAEAEHAVIACGVWSGALFKQIGLDKRFYPVKGECLSVWNDGISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELGGIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGVLLAPATGEMVADMILGNPVKTEWIEAFKAERKEAVHR
Molecular weight	67.01kDa
Purity estimated	>90% by SDS-PAGE
Buffer	30 mM potassium phosphate pH 8.0, 100 mM NaCl, 10% glycerol
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Lys3-Arg369
Aliases /Synonyms	Glycine oxidase, GO, thiO
Reference	PX-P4364
Note	For research use only
Molecular Constructor	Lys3–Arg369

Product name	Glycine oxidase (thiO) (3-369)
Uniprot ID	S5FMM4 (98,4%)
Expression system	Prokaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMRKRYDTIVIGGGIIGTSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLSAHRECDKPGTFFEFARASQKAYKRLTGELRDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYTPVLSIESEAGAVRVTSASGTAEAEHAVIACGVWSGALFKQIGLDKRFYPVKGECLSVWNDGISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELGGIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGVLLAPATGEMVADMILGNPVKTEWIEAFKAERKEAVHR
Molecular weight	67.01kDa
Purity estimated	>90% by SDS-PAGE
Buffer	30 mM potassium phosphate pH 8.0, 100 mM NaCl, 10% glycerol
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Lys3-Arg369
Aliases /Synonyms	Glycine oxidase, GO, thiO
Reference	PX-P4364
Note	For research use only
Molecular Constructor	Lys3–Arg369

There are no reviews yet.

Be the first to review “Glycine oxidase (thiO) (3-369)”

Glycine oxidase (thiO) (3-369)

Glycine oxidase (thiO) (3-369)

Related products

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade

Abagovomab Biosimilar – Anti-idiotope of anti-Mus musculus monoclonal antibody OC126 mAb – Research Grade

Igovomab Biosimilar – Anti-MUC16 mAb – Research Grade

Oregovomab Biosimilar – Anti-MUC16, CA125 mAb – Research Grade

Golimumab Biosimilar – Anti-TNFA, TNF alpha mAb – Research Grade

Atinumab Biosimilar – Anti-RTN4, NOGO mAb – Research Grade

Duligotuzumab Biosimilar – Anti-ERBB3 mAb – Research Grade

Ozanezumab Biosimilar – Anti-RTN4, NOGO mAb – Research Grade

Opicinumab Biosimilar – Anti-LINGO1, LRRN6A, LERN1 mAb – Research Grade

Gontivimab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Tiragolumab Biosimilar – Anti-TIGIT, VSIG9, VSTM3 mAb – Research Grade

Gosuranemab Biosimilar – Anti-MAPT mAb – Research Grade

Prolgolimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Astegolimab Biosimilar – Anti-IL1RL1 mAb – Research Grade

Thioredoxin 1(trxA) (Escherichia coli)

Leishmania tropica TSA Recombinant Protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Glycine oxidase (thiO) (3-369)

Specifications Glycine oxidase (thiO) (3-369)

Documents

Reviews

Related products

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade

Abagovomab Biosimilar – Anti-idiotope of anti-Mus musculus monoclonal antibody OC126 mAb – Research Grade

Igovomab Biosimilar – Anti-MUC16 mAb – Research Grade

Oregovomab Biosimilar – Anti-MUC16, CA125 mAb – Research Grade

Golimumab Biosimilar – Anti-TNFA, TNF alpha mAb – Research Grade

Atinumab Biosimilar – Anti-RTN4, NOGO mAb – Research Grade

Duligotuzumab Biosimilar – Anti-ERBB3 mAb – Research Grade

Ozanezumab Biosimilar – Anti-RTN4, NOGO mAb – Research Grade

Opicinumab Biosimilar – Anti-LINGO1, LRRN6A, LERN1 mAb – Research Grade

Gontivimab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Tiragolumab Biosimilar – Anti-TIGIT, VSIG9, VSTM3 mAb – Research Grade

Gosuranemab Biosimilar – Anti-MAPT mAb – Research Grade

Prolgolimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Astegolimab Biosimilar – Anti-IL1RL1 mAb – Research Grade

Thioredoxin 1(trxA) (Escherichia coli)

Leishmania tropica TSA Recombinant Protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Glycine oxidase (thiO) (3-369)