Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Golimumab Biosimilar – Anti-TNFA, TNF alpha mAb – Research Grade

  • PX-TA1129-100UG
  • Validated ELISA FC
Isotype:
IgG1, kappa

Original price was: $317.00.Current price is: $238.00.

100ug 25% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb - Research Grade

Product name Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb - Research Grade
Uniprot ID P01375
Source CAS 476181-74-5
Species Homo sapiens
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Golimumab,CNTO 148,TNFA, TNF alpha,anti-TNFA, TNF alpha
Reference PX-TA1129
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb - Research Grade
Uniprot ID P01375
Source CAS 476181-74-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Golimumab,CNTO 148,TNFA, TNF alpha,anti-TNFA, TNF alpha
Reference PX-TA1129
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1129-50
Uniprot ID P01375
Source CAS 476181-74-5
Species Homo sapiens
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Golimumab,CNTO 148,TNFA, TNF alpha,anti-TNFA, TNF alpha
Reference PX-TA1129
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa

General information on Anti-TNFA/TNF alpha(Homo sapiens) (Golimumab) Monoclonal Antibody

Golimumab is a human IgG1 alpha monoclonal antibody, developped from genetically engineered mice immunized with human TNFalpha. Golimumab binds to and inhibits soluble and transmembrane human TNFalpha. Elevated TNFalpha is related to chronic inflammation. Therefore, golimumab can be used in adults,for the treatment of active rheumatoid arthritis (RA), active psoriatic arthritis ( PsA), active ankylosing spondylitis (AS), ulcerative colitis (UC). In the United States and Canada, golimumab is sold under the Simponi® brand. The FDA label includes a black box that warns of serious infections and malignant tumors.

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb (cat. No.PX-TA1129) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.028M.

SDS-PAGE for Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb

SDS-PAGE for Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb - Research Grade

There are no reviews yet.

Be the first to review “Golimumab Biosimilar – Anti-TNFA, TNF alpha mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products