Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Golimumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Golimumab ELISA Kit

Golimumab ELISA Kit

Product name Golimumab ELISA Kit
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX129
Note For research use only.
Sample type Plasma, Serum
Target Golimumab
Immunogen Golimumab

Introduction to Golimumab ELISA Kit

Golimumab is a human monoclonal antibody that targets tumor necrosis factor alpha (TNF-α), a pro-inflammatory cytokine involved in various autoimmune diseases. It was first approved by the FDA in 2009 and is used as a therapeutic agent for conditions such as rheumatoid arthritis, psoriatic arthritis, and ankylosing spondylitis. The Golimumab ELISA Kit is a specialized tool designed for the detection and quantification of this antibody in biological samples.

Structure of Golimumab

Golimumab is a fully human IgG1 monoclonal antibody, meaning that it is derived from human cells and has a specific structure consisting of four polypeptide chains – two heavy chains and two light chains. The heavy chains are further divided into four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have one constant region (CL) and one variable region (VL). These regions are responsible for the binding of the antibody to its target antigen, TNF-α.

The Golimumab ELISA Kit uses a sandwich ELISA method, where the antibody is captured by a specific TNF-α antigen coated on the surface of a microplate. This is followed by the addition of a secondary antibody that is conjugated to an enzyme, which produces a colorimetric signal upon interaction with a substrate. The intensity of this signal is directly proportional to the amount of Golimumab present in the sample.

Activity of Golimumab

Golimumab exerts its therapeutic activity by binding to TNF-α and preventing it from binding to its receptors on the surface of immune cells. This inhibits the downstream signaling pathways that lead to inflammation and tissue damage. Additionally, Golimumab can also induce the apoptosis (cell death) of TNF-α producing cells, further reducing the levels of this cytokine in the body.

The Golimumab ELISA Kit can be used to measure the levels of Golimumab in patient serum, plasma, or cell culture supernatants. This allows for the monitoring of drug levels in patients undergoing treatment, ensuring that they are receiving the appropriate dosage and achieving therapeutic levels. It can also be used in pre-clinical and clinical studies to evaluate the pharmacokinetics (absorption, distribution, metabolism, and excretion) of Golimumab and its efficacy in different disease models.

Applications of Golimumab ELISA Kit

The Golimumab ELISA Kit has various applications in both research and clinical settings. In research, it can be used to study the role of TNF-α in disease progression and the effectiveness of Golimumab in targeting this cytokine. It can also aid in the development of new drugs that target TNF-α or other cytokines involved in inflammatory diseases.

In the clinical setting, the Golimumab ELISA Kit is used for therapeutic drug monitoring, ensuring that patients are receiving the appropriate dosage of Golimumab for their condition. It can also be used to monitor the levels of Golimumab in patients with autoimmune diseases, providing valuable information on the efficacy of treatment and potential need for dose adjustments.

Conclusion

The Golimumab ELISA Kit is a valuable tool for the detection and quantification of Golimumab in biological samples. Its highly specific and sensitive nature makes it an essential component in research and clinical settings, aiding in the understanding and treatment of various autoimmune diseases. By accurately measuring Golimumab levels, this kit allows for personalized treatment and improved patient outcomes.

Golimumab ELISA Kit

There are no reviews yet.

Be the first to review “Golimumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products