Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirikizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mirikizumab ELISA Kit

Mirikizumab ELISA Kit

Product name Mirikizumab ELISA Kit
Uniprot ID Q9NPF7
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX276
Note For research use only.
Sample type Plasma, Serum
Target Mirikizumab
Immunogen Mirikizumab

Introduction to Mirikizumab ELISA Kit A Revolutionary Tool for Detecting and Measuring Mirikizumab Antibodies

Mirikizumab ELISA (Enzyme-Linked Immunosorbent Assay) Kit is a cutting-edge diagnostic tool used for the detection and measurement of Mirikizumab antibodies in biological samples. Developed by leading biotechnology company, Mirikizumab ELISA Kit is a highly sensitive and specific assay that enables researchers and clinicians to accurately measure the levels of Mirikizumab antibodies in various biological samples. In this article, we will provide a comprehensive overview of the structure, activity, and application of Mirikizumab ELISA Kit.

Structure of Mirikizumab ELISA Kit:

The Mirikizumab ELISA Kit consists of a solid-phase microplate coated with a specific antigen that binds to Mirikizumab antibodies present in the sample. The microplate is divided into multiple wells, each containing a different antigen. The kit also includes a series of reagents, such as wash buffer, enzyme conjugate, and substrate, which are used to detect and quantify the Mirikizumab antibodies.

Activity of Mirikizumab ELISA Kit:

The activity of Mirikizumab ELISA Kit is based on the principle of antigen-antibody binding. When a sample containing Mirikizumab antibodies is added to the microplate, the antibodies bind to the specific antigen coated on the plate. After washing away any unbound components, an enzyme-conjugated secondary antibody is added, which binds to the Mirikizumab antibodies. The enzyme then catalyzes a colorimetric reaction, producing a measurable signal that is directly proportional to the amount of Mirikizumab antibodies present in the sample.

Application of Mirikizumab ELISA Kit:

Mirikizumab ELISA Kit has a wide range of applications in both research and clinical settings. It is primarily used for the detection and measurement of Mirikizumab antibodies in biological samples, such as serum, plasma, and cell culture supernatant. This enables researchers to monitor the levels of Mirikizumab antibodies in patients receiving Mirikizumab therapy and to assess the efficacy of the treatment.

In addition, Mirikizumab ELISA Kit can also be used to study the pharmacokinetics of Mirikizumab, i.e., the absorption, distribution, metabolism, and excretion of the drug in the body. By measuring the levels of Mirikizumab antibodies in different biological samples over time, researchers can gain valuable insights into the drug’s mechanism of action and its effects on the immune system.

Furthermore, Mirikizumab ELISA Kit is also a valuable tool for the development and validation of new Mirikizumab-based therapies. By accurately measuring the levels of Mirikizumab antibodies in preclinical and clinical studies, researchers can determine the optimal dosage and dosing regimen for these therapies.

Conclusion:

In summary, Mirikizumab ELISA Kit is a highly sensitive and specific assay that enables the detection and measurement of Mirikizumab antibodies in biological samples. Its simple and reliable procedure, along with its wide range of applications, makes it an essential tool for researchers and clinicians working in the field of Mirikizumab-based therapies. With the increasing use of Mirikizumab in the treatment of various diseases, the demand for Mirikizumab ELISA Kit is expected to grow, making it a crucial asset in the field of biotechnology and medicine.

Mirikizumab ELISA Kit

There are no reviews yet.

Be the first to review “Mirikizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products