Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade

  • PX-TA1489-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

Product name Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1884201-71-1
Species Humanized
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mirikizumab,LY-3074828,IL23A,anti-IL23A
Reference PX-TA1489
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1884201-71-1
Species Humanized
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mirikizumab,LY-3074828,IL23A,anti-IL23A
Reference PX-TA1489
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1489-50
Uniprot ID Q9NPF7
Source CAS 1884201-71-1
Species Humanized
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mirikizumab,LY-3074828,IL23A,anti-IL23A
Reference PX-TA1489
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction to Mirikizumab Biosimilar

Mirikizumab Biosimilar, also known as Anti-IL23A mAb, is a research grade monoclonal antibody that is currently in development for the treatment of various inflammatory diseases. This biosimilar is designed to mimic the activity of the original drug, mirikizumab, which is a humanized antibody targeting the cytokine interleukin-23A (IL-23A). IL-23A is a key mediator of inflammation and has been implicated in the pathogenesis of several autoimmune and inflammatory diseases, making it an attractive therapeutic target.

Structure of Mirikizumab Biosimilar

Mirikizumab Biosimilar is a recombinant, fully humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is produced using recombinant DNA technology in Chinese hamster ovary (CHO) cells and has a similar structure to the original drug, mirikizumab. The antibody consists of two heavy chains and two light chains, each with a constant and variable region. The variable region of the antibody is responsible for its specificity and binds to the IL-23A cytokine with high affinity.

Mechanism of Action

Mirikizumab Biosimilar acts by binding to the p19 subunit of IL-23A, preventing it from binding to its receptor and inhibiting downstream signaling. This results in a decrease in the production of pro-inflammatory cytokines, such as IL-17 and IL-22, which are involved in the pathogenesis of inflammatory diseases. By targeting IL-23A, Mirikizumab Biosimilar helps to regulate the immune response and reduce inflammation.

Applications of Mirikizumab Biosimilar

Mirikizumab Biosimilar is being investigated for its potential use in the treatment of various inflammatory diseases, including psoriasis, psoriatic arthritis, Crohn’s disease, ulcerative colitis, and ankylosing spondylitis. These diseases are characterized by chronic inflammation and are thought to be driven by an overactive immune response. By targeting IL-23A, Mirikizumab Biosimilar has the potential to provide a more targeted and effective treatment option for these diseases.

Research Grade vs Therapeutic Grade

Mirikizumab Biosimilar is currently in the research stage and is not yet approved for therapeutic use. Research grade antibodies are typically used in preclinical studies to evaluate the efficacy and safety of a drug before it can be tested in humans. These antibodies are produced in small quantities and may not meet the same quality standards as therapeutic grade antibodies. However, research grade antibodies can still provide valuable information about the potential therapeutic effects of a drug.

Advantages of Mirikizumab Biosimilar

As a biosimilar of mirikizumab, Mirikizumab Biosimilar offers several potential advantages over the original drug. One of the main advantages is cost, as biosimilars are typically more affordable than their originator drugs. This can make treatment more accessible for patients and reduce the burden on healthcare systems. Additionally, Mirikizumab Biosimilar may have a similar efficacy and safety profile to the original drug, making it a viable alternative for patients who may not respond well to mirikizumab.

Conclusion

Mirikizumab Biosimilar, also known as Anti-IL23A mAb, is a research grade monoclonal antibody that targets the cytokine IL-23A. It has a similar structure and mechanism of action to the original drug, mirikizumab, and is being investigated for its potential use in the treatment of various inflammatory diseases. As a biosimilar, Mirikizumab Biosimilar offers potential cost and accessibility advantages over the originator drug. Further research and clinical trials are needed to determine the efficacy and safety of this biosimilar for therapeutic use.

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Human IL23A recombinant protein(cat. No.PX-P5123) at 0.5µg/mL (100µL/well) can bind Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

SDS-PAGE for Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

There are no reviews yet.

Be the first to review “Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products