Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Romosozumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Romosozumab ELISA Kit

Romosozumab ELISA Kit

Product name Romosozumab ELISA Kit
Uniprot ID Q9BQB4
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX275
Note For research use only.
Sample type Plasma, Serum
Target Romosozumab
Immunogen Romosozumab

Introduction

The Romosozumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Romosozumab, a monoclonal antibody used in the treatment of osteoporosis. This kit is designed for use in research and clinical laboratories to measure the levels of Romosozumab in various biological samples. In this article, we will provide a detailed description of the structure, activity, and application of this ELISA kit.

Structure of Romosozumab

Romosozumab is a humanized monoclonal antibody that targets the protein sclerostin. It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions of Romosozumab are responsible for binding to the target protein, while the constant regions provide stability and effector functions.

The molecular weight of Romosozumab is approximately 150 kDa, and it has a half-life of approximately 28 days in the human body. The antibody is produced using recombinant DNA technology, making it a highly pure and specific therapeutic agent.

Mechanism of Action

Romosozumab works by binding to the protein sclerostin, which is a natural inhibitor of bone formation. By blocking the activity of sclerostin, Romosozumab promotes the formation of new bone and inhibits bone resorption, thereby increasing bone density and reducing the risk of fractures in patients with osteoporosis.

Studies have shown that Romosozumab has a dual effect on bone remodeling, promoting both bone formation and bone resorption. This unique mechanism of action makes it a highly effective therapeutic target for the treatment of osteoporosis.

Application of Romosozumab ELISA Kit

The Romosozumab ELISA Kit is a valuable tool for the measurement of Romosozumab levels in various biological samples. It can be used in both research and clinical settings to monitor the response to treatment, assess drug efficacy, and identify potential adverse effects.

One of the major applications of this kit is in clinical trials, where it is used to measure the pharmacokinetics and pharmacodynamics of Romosozumab in patients with osteoporosis. It can also be used to determine the optimal dosage and dosing regimen for individual patients.

In addition, the Romosozumab ELISA Kit can be used to monitor the levels of Romosozumab in patients receiving long-term treatment, as well as in patients with conditions that may affect drug metabolism and clearance. This information can help clinicians make informed decisions regarding treatment adjustments and potential drug interactions.

Conclusion

The Romosozumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Romosozumab in various biological samples. Its unique mechanism of action and high efficacy make it a promising therapeutic target for the treatment of osteoporosis. This ELISA kit has numerous applications in research and clinical settings, making it a valuable tool for understanding the pharmacokinetics and pharmacodynamics of Romosozumab and optimizing its use in patient care.

Keywords

Antibody, therapeutic target, Romosozumab ELISA Kit, osteoporosis, sclerostin, bone formation, bone resorption, pharmacokinetics, pharmacodynamics, clinical trials, drug efficacy, adverse effects, drug metabolism, drug interactions.

Romosozumab ELISA Kit

There are no reviews yet.

Be the first to review “Romosozumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products