Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Romosozumab Biosimilar – Anti-SOST mAb – Research Grade

  • PX-TA1281-50
  • Validated ELISA
Isotype:
IgG2, Kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Romosozumab Biosimilar - Anti-SOST mAb - Research Grade

Product name Romosozumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 909395-70-6
Species Humanized
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Romosozumab,785A070802,AMG 785,CDP-7851,romosozumab-aqqg,sclerostin Ab,SOST,anti-SOST
Reference PX-TA1281
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Romosozumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 909395-70-6
Species Humanized
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Romosozumab,785A070802,AMG 785,CDP-7851,romosozumab-aqqg,sclerostin Ab,SOST,anti-SOST
Reference PX-TA1281
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1281-50
Uniprot ID Q9BQB4
Source CAS 909395-70-6
Species Humanized
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Romosozumab,785A070802,AMG 785,CDP-7851,romosozumab-aqqg,sclerostin Ab,SOST,anti-SOST
Reference PX-TA1281
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa

General information on Anti-SOST[Homo sapiens] (Romosozumab) Monoclonal Antibody

Romosozumab is a humanized monoclonal antibody used for the treatment of osteoperosis.

SDS-PAGE for Romosozumab Biosimilar - Anti-SOST mAb

SDS-PAGE for Romosozumab Biosimilar - Anti-SOST mAb

Romosozumab Biosimilar - Anti-SOST mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Romosozumab Biosimilar - Anti-SOST mAb binds to Human SOST recombinant protein in Indirect ELISA Assay

Romosozumab Biosimilar - Anti-SOST mAb binds to Human SOST recombinant protein in Indirect ELISA Assay

Immobilized Human SOST recombinant protein (cat. No.PX-P6275) at 0.5µg/mL (100µL/well) can bind to Romosozumab Biosimilar - Anti-SOST mAb (cat. No.PX-TA1281) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Romosozumab Biosimilar - Anti-SOST mAb - Research Grade

There are no reviews yet.

Be the first to review “Romosozumab Biosimilar – Anti-SOST mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products