Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sclerostin (SOST )

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9BQB4

Original price was: $258.00.Current price is: $217.00.

50ug 16% OFF + 217 loyalty points
Gln24–Tyr213
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sclerostin (SOST )

Product name Sclerostin (SOST )
Uniprot ID Q9BQB4
Uniprot link http://www.uniprot.org/uniprot/Q9BQB4
Expression system Prokaryotic expression
Raw Antigen Sequence GQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENA
Purity estimated >40%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Tyr213
Aliases /Synonyms Sclerostin
Reference PX-P4621
Note For research use only
Molecular Constructor
Gln24–Tyr213
Product name Sclerostin (SOST )
Uniprot ID Q9BQB4
Uniprot link http://www.uniprot.org/uniprot/Q9BQB4
Expression system Prokaryotic expression
Raw Antigen Sequence GQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENA
Purity estimated >40%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Tyr213
Aliases /Synonyms Sclerostin
Reference PX-P4621
Note For research use only
Molecular Constructor
Gln24–Tyr213
Product name PX-P4621-1MG
Uniprot ID Q9BQB4
Uniprot link http://www.uniprot.org/uniprot/Q9BQB4
Expression system Prokaryotic expression
Raw Antigen Sequence GQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENA
Purity estimated >40%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Tyr213
Aliases /Synonyms Sclerostin
Reference PX-P4621
Note For research use only
Molecular Constructor
Gln24–Tyr213

General Information about Sclerostin (SOST)

Sclerostin is a protein encoded by the SOST gene in humans. Sclerostin is a secreted glycoprotein with a C-terminal cysteine ​​knot-like (CTCK) domain, and its sequence is different from that of the bone morphogenetic protein (BMP) antagonist DAN (differential selection gene in neuroblastoma) . Sclerostin is mainly produced by bone cells, but it can also be expressed in other tissues and has an anti-anabolic effect on bone formation.

Sclerostin (SOST )

There are no reviews yet.

Be the first to review “Sclerostin (SOST )”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products