Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Blosozumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Blosozumab ELISA Kit

Blosozumab ELISA Kit

Product name Blosozumab ELISA Kit
Uniprot ID Q9BQB4
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX274
Note For research use only.
Sample type Plasma, Serum
Target Blosozumab
Immunogen Blosozumab

Introduction to Blosozumab ELISA Kit A Revolutionary Tool for Studying Antibody Structure and Activity

Blosozumab ELISA Kit is a cutting-edge scientific tool that has revolutionized the study of antibodies and their therapeutic targets. This kit is designed to accurately measure the structure and activity of antibodies, providing researchers with valuable insights into their function and potential applications. In this article, we will delve into the details of Blosozumab ELISA Kit, its components, and its wide range of applications.

Title: Understanding the

Structure of Antibodies with Blosozumab ELISA Kit

Antibodies are an essential component of the immune system and play a crucial role in defending the body against foreign invaders. The structure of antibodies consists of two heavy and two light chains, which are held together by disulfide bonds. Blosozumab ELISA Kit utilizes a sandwich ELISA method to accurately measure the structure of antibodies. This method involves the use of two specific antibodies, one that binds to the heavy chain and another that binds to the light chain, allowing for the detection of the intact antibody structure.

Title: Measuring Antibody Activity with Blosozumab ELISA Kit

Apart from studying the structure of antibodies, Blosozumab ELISA Kit is also a powerful tool for measuring their activity. Antibodies can have various activities, such as neutralizing toxins, binding to antigens, and activating immune cells. Blosozumab ELISA Kit utilizes a colorimetric method to measure the activity of antibodies. This method involves the use of a substrate that changes color in the presence of an active antibody, providing a quantitative measurement of its activity.

Title: Blosozumab ELISA Kit for

Therapeutic Target Identification

One of the most significant applications of Blosozumab ELISA Kit is in identifying potential therapeutic targets. Antibodies have been increasingly used as therapeutic agents in various diseases, including cancer, autoimmune disorders, and infectious diseases. Blosozumab ELISA Kit can accurately detect and measure the activity of antibodies against a specific target, providing valuable information for the development of targeted therapies.

Advantages of Blosozumab ELISA Kit over Other Methods

Blosozumab ELISA Kit offers several advantages over other methods of studying antibody structure and activity. Traditional methods, such as Western blotting and immunohistochemistry, are time-consuming, require large sample volumes, and lack sensitivity. On the other hand, Blosozumab ELISA Kit is a rapid, sensitive, and cost-effective method that requires minimal sample volume, making it ideal for high-throughput studies.

Title: Potential Applications of Blosozumab ELISA Kit in Research and Clinical Settings The versatility of Blosozumab ELISA Kit makes it a valuable tool for a wide range of research and clinical applications. In research, this kit can be used to study the structure and activity of antibodies in various diseases, elucidating their role in disease progression and identifying potential therapeutic targets. In the clinical setting, Blosozumab ELISA Kit can be used for early detection and monitoring of disease progression, as well as evaluating the efficacy of antibody-based therapies.

In conclusion, Blosozumab ELISA Kit is a powerful tool for studying antibody structure and activity, with numerous potential applications in research and clinical settings. Its accurate and sensitive measurement capabilities make it an essential tool for understanding the role of antibodies in health and disease. With its growing popularity and widespread use, Blosozumab ELISA Kit is set to revolutionize the field of antibody research and contribute to the development of novel therapeutic strategies.

Blosozumab ELISA Kit

There are no reviews yet.

Be the first to review “Blosozumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products