Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade

  • PX-TA1267-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade

Product name Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1132758-87-2
Species Humanized
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference PX-TA1267
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1132758-87-2
Species Humanized
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference PX-TA1267
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1267-50
Uniprot ID Q9BQB4
Source CAS 1132758-87-2
Species Humanized
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference PX-TA1267
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information on Anti-SOST(sclerostin)[Homo sapiens] (Blosozumab) Monoclonal Antibody

Blosozumab has been inestigated for the treatment of Osteoporosis.

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Immobilized Human SOST recombinant protein (cat. No.PX-P6275) at 0.5µg/mL (100µL/well) can bind to Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb (cat. No.PX-TA1267) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade

There are no reviews yet.

Be the first to review “Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products