Brand: ProteoGenix

Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade

PX-TA1267-50
Validated ELISA

Clonality:: Monoclonal Antibody
Isotype:: IgG4, Kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points

Size Size

50ug Original price was: $209.00.Current price is: $167.00.
100ug Original price was: $326.00.Current price is: $238.00.
1MG Original price was: $670.00.Current price is: $482.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade

Product name	Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade
Uniprot ID	Q9BQB4
Source	CAS 1132758-87-2
Species	Humanized
Raw Antigen Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference	PX-TA1267
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG4-kappa
Clonality	Monoclonal Antibody

Product name	Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade
Uniprot ID	Q9BQB4
Source	CAS 1132758-87-2
Species	Humanized
Raw Antigen Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference	PX-TA1267
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG4-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1267-50
Uniprot ID	Q9BQB4
Source	CAS 1132758-87-2
Species	Humanized
Raw Antigen Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference	PX-TA1267
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG4, Kappa
Clonality	Monoclonal Antibody

General information on Anti-SOST(sclerostin)[Homo sapiens] (Blosozumab) Monoclonal Antibody

Blosozumab has been inestigated for the treatment of Osteoporosis.

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Immobilized Human SOST recombinant protein (cat. No.PX-P6275) at 0.5µg/mL (100µL/well) can bind to Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb (cat. No.PX-TA1267) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade

General information on Anti-SOST(sclerostin)[Homo sapiens] (Blosozumab) Monoclonal Antibody

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Related products

Lysostaphin(lss)

Sclerostin (SOST )

Human IgG4 Isotype Control antibody

Blosozumab ELISA Kit

InVivoMAb Anti-Human SOST Antibody (Iv0185)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade

Specifications Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade

Description

General information on Anti-SOST(sclerostin)[Homo sapiens] (Blosozumab) Monoclonal Antibody

Documents

QC & Validation

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

3D Representation

Reviews

Related products

Lysostaphin(lss)

Sclerostin (SOST )

Human IgG4 Isotype Control antibody

Blosozumab ELISA Kit

InVivoMAb Anti-Human SOST Antibody (Iv0185)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade