Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mycoplasma LppA Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Mycoplasma
Uniprot ID:
P55801
Molecular weight:
62,97 kDa

$782.00

100ug + 782 loyalty points
Full-length Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mycoplasma LppA Recombinant Protein

Product name Mycoplasma LppA Recombinant Protein
Uniprot ID P55801
Uniprot link http://www.uniprot.org/uniprot/P55801
Origin species Mycoplasma
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMISNSCSTRNSNAKQPDKKPEKPNENTPKTPSKPDESKQPDNNNTNPGDSNNGSNNPEIK PDPSENPQSDQPMDKPDEKIDKPSHSDKPQADDSNNNRDIFSDLDKISKEISFETFSFYTQRDAVTALVDLQKDPSTIYT IFSKDYKTIFDKYHIQFLANNEESANNEKGLIEKVKLKFTHKKFDQSKILDFIFTGFKKNEYTSITNNKEKYITKREKVE KITDLFPSLIGYVLLYSQDHNQYKNLMEAKNVINFEDLENGNSSLFIDKAPLLNVATIKDYLFEFNPELGKLYKEKITAV KYDDYNGILGVKLEIENRDFDPKTTKEPIIEKEFVFDNFRKVNIKDNEKNPLSLFLTQDKFKEMTKSGLLKTKIQELRSS NKLEKKELLQDKKIDFLKQQIFKNLLVDINDNSHNIYRSQSTLSLGSNKTYKSILGLAGGFSIYPFHTSINKDSIKNIYL SINKDEENVHKAIIEFEVYIPVFSTGFSDLKSYATSGDEKYLVLKIVQTTSIQCGRGSHHHHHHHHHH
Molecular weight 62,97 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, imidazole 250mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_975025.1
Spec:Entrez GeneID 2744850
Spec:SwissProtID P55801
NCBI Reference NP_975025.1
Aliases /Synonyms LppA, immunodominant protein P72, MSC_0014, P72
Reference PX-P1122
Note For research use only
Molecular Constructor
Full-length Yes
Product name Mycoplasma LppA Recombinant Protein
Uniprot ID P55801
Uniprot link http://www.uniprot.org/uniprot/P55801
Origin species Mycoplasma
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMISNSCSTRNSNAKQPDKKPEKPNENTPKTPSKPDESKQPDNNNTNPGDSNNGSNNPEIK PDPSENPQSDQPMDKPDEKIDKPSHSDKPQADDSNNNRDIFSDLDKISKEISFETFSFYTQRDAVTALVDLQKDPSTIYT IFSKDYKTIFDKYHIQFLANNEESANNEKGLIEKVKLKFTHKKFDQSKILDFIFTGFKKNEYTSITNNKEKYITKREKVE KITDLFPSLIGYVLLYSQDHNQYKNLMEAKNVINFEDLENGNSSLFIDKAPLLNVATIKDYLFEFNPELGKLYKEKITAV KYDDYNGILGVKLEIENRDFDPKTTKEPIIEKEFVFDNFRKVNIKDNEKNPLSLFLTQDKFKEMTKSGLLKTKIQELRSS NKLEKKELLQDKKIDFLKQQIFKNLLVDINDNSHNIYRSQSTLSLGSNKTYKSILGLAGGFSIYPFHTSINKDSIKNIYL SINKDEENVHKAIIEFEVYIPVFSTGFSDLKSYATSGDEKYLVLKIVQTTSIQCGRGSHHHHHHHHHH
Molecular weight 62,97 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, imidazole 250mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_975025.1
Spec:Entrez GeneID 2744850
Spec:SwissProtID P55801
NCBI Reference NP_975025.1
Aliases /Synonyms LppA, immunodominant protein P72, MSC_0014, P72
Reference PX-P1122
Note For research use only
Molecular Constructor
Full-length Yes

General information on Mycoplasma LppA Recombinant Protein:

Immunodominant protein p72 from Mycoplasma mycoides subsp. mycoides SC is a member of the mycoplasma p72 lipoprotein family. It has been shown to be a surface-exposed lipoprotein of Mycoplasma mycoides subsp. mycoides SC. The protein may play an essential role in virulence.

  • Frey J, Cheng X, Monnerat MP, Abdo EM, Krawinkler M, Bölske G, Nicolet J. Genetic and serological analysis of the immunogenic 67-kDa lipoprotein of Mycoplasma sp. bovine group 7. Res Microbiol. 1998 Jan;149(1):55-64. PubMed PMID: 9766210.
  • Cheng X, Nicolet J, Miserez R, Kuhnert P, Krampe M, Pilloud T, Abdo EM, Griot C, Frey J. Characterization of the gene for an immunodominant 72 kDa lipoprotein of Mycoplasma mycoides subsp. mycoides small colony type. Microbiology. 1996 Dec;142 ( Pt 12):3515-24. PubMed PMID: 9004514.
  • Westberg J, Persson A, Holmberg A, Goesmann A, Lundeberg J, Johansson KE, Pettersson B, Uhlén M. The genome sequence of Mycoplasma mycoides subsp. mycoides SC type strain PG1T, the causative agent of contagious bovine pleuropneumonia (CBPP). Genome Res. 2004 Feb;14(2):221-7. PubMed PMID: 14762060; PubMed Central PMCID: PMC327097.

There are no reviews yet.

Be the first to review “Mycoplasma LppA Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products