Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Listeriolysin O(hly)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P13128
Molecular weight:
56.94KDa

Original price was: $290.00.Current price is: $250.00.

50ug 14% OFF + 250 loyalty points
Asp26–Glu529 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Listeriolysin O(hly)

Product name Listeriolysin O(hly)
Uniprot ID P13128
Uniprot link https://www.uniprot.org/uniprot/P13128
Expression system Prokaryotic expression
Raw Antigen Sequence DASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE
Molecular weight 56.94KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl,3mM Cysteine,0.3mM Cystine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-Glu529
Protein Accession P13128
Spec:Entrez GeneID 987033
Spec:SwissProtID Q48747
NCBI Reference P13128
Aliases /Synonyms hly/Listeriolysin O
Reference PX-P4407
Note For research use only
Molecular Constructor
Asp26–Glu529 His
Product name Listeriolysin O(hly)
Uniprot ID P13128
Uniprot link https://www.uniprot.org/uniprot/P13128
Expression system Prokaryotic expression
Raw Antigen Sequence DASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE
Molecular weight 56.94KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl,3mM Cysteine,0.3mM Cystine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-Glu529
Protein Accession P13128
Spec:Entrez GeneID 987033
Spec:SwissProtID Q48747
NCBI Reference P13128
Aliases /Synonyms hly/Listeriolysin O
Reference PX-P4407
Note For research use only
Molecular Constructor
Asp26–Glu529 His
Product name PX-P4407-1MG
Uniprot ID P13128
Uniprot link https://www.uniprot.org/uniprot/P13128
Expression system Prokaryotic expression
Raw Antigen Sequence DASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE
Molecular weight 56.94KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl,3mM Cysteine,0.3mM Cystine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-Glu529
Protein Accession P13128
Spec:Entrez GeneID 987033
Spec:SwissProtID Q48747
NCBI Reference P13128
Aliases /Synonyms hly/Listeriolysin O
Reference PX-P4407
Note For research use only
Molecular Constructor
Asp26–Glu529 His

Listeriolysin O(hly)

There are no reviews yet.

Be the first to review “Listeriolysin O(hly)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products