Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

RNA-binding protein 38(RBM38)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9H0Z9
Molecular weight:
38.3kDa

$392.00

100ug + 392 loyalty points
GST Thr132–Gln239
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

RNA-binding protein 38(RBM38)

Product name RNA-binding protein 38(RBM38)
Uniprot ID Q9H0Z9
Uniprot link https://www.uniprot.org/uniprot/Q9H0Z9
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight 38.3kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH 7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr132-Gln239
Protein Accession Q9H0Z9
Spec:Entrez GeneID 55544
Spec:NCBI Gene Aliases RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference Q9H0Z9
Aliases /Synonyms CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference PX-P4832
Note For research use only
Molecular Constructor
GST Thr132–Gln239
Product name RNA-binding protein 38(RBM38)
Uniprot ID Q9H0Z9
Uniprot link https://www.uniprot.org/uniprot/Q9H0Z9
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Molecular weight 38.3kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH 7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr132-Gln239
Protein Accession Q9H0Z9
Spec:Entrez GeneID 55544
Spec:NCBI Gene Aliases RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Reference Q9H0Z9
Aliases /Synonyms CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4
Reference PX-P4832
Note For research use only
Molecular Constructor
GST Thr132–Gln239

There are no reviews yet.

Be the first to review “RNA-binding protein 38(RBM38)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products