Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Angiopoietin-related protein 3(Angptl3)

  • PX-P4758-10
Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9R182
Molecular weight:
26.08kDa

$217.00

+ 217 loyalty points
Ser17–Arg224
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Angiopoietin-related protein 3(Angptl3)

Angiopoietin-related protein 3(Angptl3)

Product name Angiopoietin-related protein 3(Angptl3)
Uniprot ID Q9R182
Uniprot link https://www.uniprot.org/uniprot/Q9R182
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGLVPRGSHMSRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTGIQEPSENSLSSKSRAPR
Molecular weight 26.08kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Arg224
Aliases /Synonyms Angiopoietin-like protein 3
Reference PX-P4758
Note For research use only
Molecular Constructor
Ser17–Arg224
Product name Angiopoietin-related protein 3(Angptl3)
Uniprot ID Q9R182
Uniprot link https://www.uniprot.org/uniprot/Q9R182
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGLVPRGSHMSRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTGIQEPSENSLSSKSRAPR
Molecular weight 26.08kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Arg224
Aliases /Synonyms Angiopoietin-like protein 3
Reference PX-P4758
Note For research use only
Molecular Constructor
Ser17–Arg224

There are no reviews yet.

Be the first to review “Angiopoietin-related protein 3(Angptl3)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products