Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

STRO-001 Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade

  • PX-TA1913-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: $572.00.Current price is: $440.00.

100ug 23% OFF + 440 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

Product name STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source SP7219
Species Homo sapiens
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLA-DR antigens-associated invariant chain,HLA class II histocompatibility antigen gamma chain,CD74,CLIP,Ia antigen-associated invariant chain,DHLAG,Ii,SP7219
Reference PX-TA1913
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source SP7219
Species Homo sapiens
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLA-DR antigens-associated invariant chain,HLA class II histocompatibility antigen gamma chain,CD74,CLIP,Ia antigen-associated invariant chain,DHLAG,Ii,SP7219
Reference PX-TA1913
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name PX-TA1913-50
Uniprot ID P04233
Source SP7219
Species Homo sapiens
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLA-DR antigens-associated invariant chain,HLA class II histocompatibility antigen gamma chain,CD74,CLIP,Ia antigen-associated invariant chain,DHLAG,Ii,SP7219
Reference PX-TA1913
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Introduction

STRO-001 Biosimilar is a novel monoclonal antibody (mAb) that targets the HLA-DR antigens-associated invariant chain (Ii). It is a research grade mAb that has shown promising results in preclinical studies as a potential therapeutic agent for various diseases. In this article, we will discuss the structure, activity, and potential applications of STRO-001 Biosimilar.

Structure of STRO-001 Biosimilar

STRO-001 Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains are approximately 50 kDa in size and contain four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains are approximately 25 kDa in size and contain one constant domain (CL) and one variable domain (VL). The variable domains of both heavy and light chains are responsible for binding to the target antigen, HLA-DR Ii.

Activity of STRO-001 Biosimilar

The main activity of STRO-001 Biosimilar is to target and bind to the HLA-DR Ii antigen. HLA-DR Ii is a type II transmembrane protein that is expressed on the surface of antigen-presenting cells (APCs) such as B cells, dendritic cells, and macrophages. It plays a crucial role in the presentation of antigens to T cells. STRO-001 Biosimilar binds to HLA-DR Ii with high affinity, thereby blocking the interaction between HLA-DR Ii and the T cell receptor (TCR). This leads to the inhibition of T cell activation and subsequent immune response.

In addition to its primary activity, STRO-001 Biosimilar also has other potential activities. It has been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against HLA-DR Ii-expressing cells. This further enhances its therapeutic potential by promoting the destruction of targeted cells.

Applications of STRO-001 Biosimilar

STRO-001 Biosimilar has potential applications in various diseases where the dysregulation of the immune system plays a role. Some of the potential therapeutic targets of STRO-001 Biosimilar include:

1. B cell malignancies: HLA-DR Ii is highly expressed on the surface of B cell malignancies such as non-Hodgkin’s lymphoma and chronic lymphocytic leukemia. STRO-001 Biosimilar has shown promising results in preclinical studies as a potential treatment for these diseases.

2. Autoimmune diseases: The dysregulation of T cell activation is a key feature of autoimmune diseases. By targeting HLA-DR Ii, STRO-001 Biosimilar can potentially modulate the immune response and provide a novel approach for the treatment of autoimmune diseases.

3. Solid tumors: HLA-DR Ii has been found to be expressed on the surface of solid tumors such as breast, lung, and ovarian cancer. STRO-001 Biosimilar has shown potential in preclinical studies as a therapeutic agent for these types of cancer.

Conclusion

STRO-001 Biosimilar is a novel monoclonal antibody that targets the HLA-DR Ii antigen. Its structure, activity, and potential applications make it a promising candidate for the treatment of various diseases. Further clinical studies are needed to fully understand the therapeutic potential of this biosimilar. However, the preclinical data so far is encouraging and suggests that STRO-001 Biosimilar could be a valuable addition to the current arsenal of therapeutic antibodies.

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade in ELISA Assay

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade in ELISA Assay

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade

SDS-PAGE for STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

There are no reviews yet.

Be the first to review “STRO-001 Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products