Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Milatuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Milatuzumab ELISA Kit

Milatuzumab ELISA Kit

Product name Milatuzumab ELISA Kit
Uniprot ID P04233
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX143
Note For research use only.
Sample type Plasma, Serum
Target Milatuzumab
Immunogen Milatuzumab

Introduction

Milatuzumab is a humanized monoclonal antibody that specifically targets CD74, a cell surface protein that is overexpressed in various cancer cells. This antibody has shown promising therapeutic potential in the treatment of hematological malignancies and solid tumors. The Milatuzumab ELISA Kit is a specialized tool that allows for the detection and quantification of this antibody in biological samples. In this article, we will discuss the structure, activity, and applications of the Milatuzumab ELISA Kit.

Structure of Milatuzumab

Milatuzumab is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of Milatuzumab is responsible for its high specificity towards CD74. The constant region, on the other hand, is responsible for its effector functions, such as complement-dependent cytotoxicity and antibody-dependent cellular cytotoxicity.

Activity of Milatuzumab

The primary function of Milatuzumab is to bind to CD74, a cell surface protein that is involved in the regulation of immune responses. CD74 is overexpressed in various cancer cells, making it an attractive therapeutic target. By binding to CD74, Milatuzumab can inhibit its signaling pathways, leading to the suppression of cancer cell growth and survival. Additionally, Milatuzumab can also induce antibody-dependent cellular cytotoxicity, where the antibody binds to cancer cells and activates immune cells to kill them.

Application of Milatuzumab ELISA Kit

The Milatuzumab ELISA Kit is a valuable tool for researchers and clinicians to detect and quantify the levels of Milatuzumab in biological samples. This kit is specifically designed to measure the amount of Milatuzumab in serum, plasma, and other biological fluids. It utilizes a sandwich ELISA technique, where Milatuzumab is captured by a CD74-coated plate and then detected by a specific enzyme-conjugated antibody. The resulting color change is then measured and correlated to the concentration of Milatuzumab in the sample.

The Milatuzumab ELISA Kit has various applications in both research and clinical settings. In research, it can be used to monitor the efficacy of Milatuzumab in cancer patients, as well as to study the pharmacokinetics and pharmacodynamics of this antibody. In clinical settings, the kit can aid in the diagnosis and monitoring of patients with CD74-expressing cancers, such as multiple myeloma and non-Hodgkin’s lymphoma. It can also be used to assess the response to Milatuzumab treatment and to determine the optimal dosage for individual patients.

Conclusion

In conclusion, the Milatuzumab ELISA Kit is a valuable tool for the detection and quantification of Milatuzumab in biological samples. This antibody, with its high specificity towards CD74, has shown promising therapeutic potential in the treatment of various cancers. The Milatuzumab ELISA Kit can aid in the research and clinical applications of this antibody, providing valuable insights into its efficacy and pharmacokinetics. With its easy-to-use format and high sensitivity, this kit is a valuable asset in the field of oncology and immunotherapy.

Milatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Milatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products