Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Milatuzumab Biosimilar – Anti-CD74 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

Product name Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade
Uniprot ID P04233
Source CAS 899796-83-9
Species Humanized
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Milatuzumab,CD74-DOX (ADC),MEDI-115,hLL1,hLL1-DOX (ADC),CD74,anti-CD74
Reference PX-TA1095
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade
Uniprot ID P04233
Source CAS 899796-83-9
Species Humanized
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Milatuzumab,CD74-DOX (ADC),MEDI-115,hLL1,hLL1-DOX (ADC),CD74,anti-CD74
Reference PX-TA1095
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1095-50
Uniprot ID P04233
Source CAS 899796-83-9
Species Humanized
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Milatuzumab,CD74-DOX (ADC),MEDI-115,hLL1,hLL1-DOX (ADC),CD74,anti-CD74
Reference PX-TA1095
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction:

Milatuzumab Biosimilar is a research grade monoclonal antibody (mAb) that specifically targets CD74, a cell surface protein that is overexpressed in various cancers and autoimmune diseases. This biosimilar is a highly promising therapeutic agent that has shown great potential in preclinical studies and clinical trials.

Structure:

Milatuzumab Biosimilar is a fully humanized IgG1 mAb, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to CD74, while the constant region is responsible for effector functions such as complement activation and antibody-dependent cellular cytotoxicity.

Activity:

The primary function of Milatuzumab Biosimilar is to bind to CD74, a cell surface protein that is involved in various cellular processes such as antigen presentation, cell proliferation, and survival. By binding to CD74, this biosimilar blocks its activity and disrupts the signaling pathways that promote cancer cell growth and survival. In addition, Milatuzumab Biosimilar also induces antibody-dependent cellular cytotoxicity, leading to the destruction of cancer cells by immune cells.

Application:

Milatuzumab Biosimilar has shown promising results in preclinical studies and clinical trials for the treatment of various cancers and autoimmune diseases. It has been studied in multiple myeloma, non-Hodgkin’s lymphoma, and chronic lymphocytic leukemia, where it has demonstrated significant anti-tumor activity and improved patient outcomes. In addition, this biosimilar has also shown potential in the treatment of autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus, by targeting CD74-expressing immune cells that contribute to the disease.

Benefits:

The use of Milatuzumab Biosimilar as a therapeutic agent offers several benefits over traditional treatments. As a fully humanized antibody, it has a lower risk of immunogenicity, making it a safer option for patients. It also has a longer half-life compared to other treatments, allowing for less frequent dosing and improved patient compliance. Additionally, Milatuzumab Biosimilar has shown minimal side effects in clinical trials, making it a well-tolerated treatment option.

Future prospects:

The potential of Milatuzumab Biosimilar extends beyond its current applications. Ongoing research is exploring its use in combination with other treatments, such as chemotherapy and immunotherapy, to enhance its anti-tumor activity. Furthermore, the development of this biosimilar has opened up opportunities for the discovery and development of other CD74-targeting therapies for various diseases.

Conclusion:

In conclusion, Milatuzumab Biosimilar is a highly promising therapeutic agent that specifically targets CD74, a protein involved in cancer and autoimmune diseases. Its structure, activity, and potential applications make it a valuable addition to the treatment options for these diseases. With ongoing research and development, this biosimilar has the potential to significantly improve patient outcomes and pave the way for the development of other CD74-targeting therapies.

SDS-PAGE for Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

SDS-PAGE for Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

There are no reviews yet.

Be the first to review “Milatuzumab Biosimilar – Anti-CD74 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products