Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iladatuzumab Biosimilar – Anti-CD79B mAb – Research Grade

  • PX-TA1488-100UG
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $312.00.Current price is: $238.00.

100ug 24% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

Product name Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade
Uniprot ID P40259
Source CAS 1906205-76-2
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Iladatuzumab,MCDS0593A,RO7032005,CD79B,anti-CD79B
Reference PX-TA1488
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade
Uniprot ID P40259
Source CAS 1906205-76-2
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Iladatuzumab,MCDS0593A,RO7032005,CD79B,anti-CD79B
Reference PX-TA1488
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1488-50
Uniprot ID P40259
Source CAS 1906205-76-2
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Iladatuzumab,MCDS0593A,RO7032005,CD79B,anti-CD79B
Reference PX-TA1488
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Iladatuzumab Biosimilar – Anti-CD79B mAb

Iladatuzumab Biosimilar is a monoclonal antibody (mAb) that specifically targets CD79B, a protein found on the surface of B-cells. This biosimilar is a research grade version of the original Iladatuzumab, which was developed as a therapeutic antibody for the treatment of B-cell malignancies. In this article, we will explore the structure, activity, and potential applications of Iladatuzumab Biosimilar.

Structure of Iladatuzumab Biosimilar

Iladatuzumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the target protein, CD79B. The constant region determines the effector functions of the antibody, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

Iladatuzumab Biosimilar binds to CD79B on the surface of B-cells, leading to the inhibition of B-cell receptor (BCR) signaling. This results in the suppression of B-cell proliferation and survival, making it a potential therapeutic agent for B-cell malignancies such as non-Hodgkin’s lymphoma and chronic lymphocytic leukemia. Additionally, Iladatuzumab Biosimilar can also induce ADCC and CDC, which can further enhance its anti-tumor activity.

Title: Applications of Iladatuzumab Biosimilar

Iladatuzumab Biosimilar has shown promising results in preclinical studies as a potential treatment for B-cell malignancies. It has also been evaluated in clinical trials as a biosimilar to the original Iladatuzumab. These trials have demonstrated its safety, tolerability, and efficacy in patients with B-cell malignancies. Iladatuzumab Biosimilar is currently being developed for the treatment of relapsed or refractory B-cell malignancies, with the potential to be used as a first-line therapy in the future.

Advantages of Iladatuzumab Biosimilar

As a biosimilar, Iladatuzumab Biosimilar offers several advantages over the original Iladatuzumab. It is produced using a well-established and cost-effective recombinant DNA technology, making it more affordable and accessible for patients. Additionally, it has a high degree of similarity to the original Iladatuzumab in terms of structure, function, and clinical efficacy, ensuring its safety and efficacy for patients.

Conclusion

Iladatuzumab Biosimilar is a promising therapeutic antibody that specifically targets CD79B, a protein found on the surface of B-cells. Its unique mechanism of action, along with its potential for use in various B-cell malignancies, makes it a promising treatment option for patients. As a biosimilar, it offers several advantages over the original Iladatuzumab, making it a cost-effective and accessible option for patients in need. Further clinical studies and developments are needed to fully realize the potential of Iladatuzumab Biosimilar as a therapeutic agent.

Flow Cytometry results for Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

Flow Cytometry results for Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade in WB Assay

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade in WB Assay

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

There are no reviews yet.

Be the first to review “Iladatuzumab Biosimilar – Anti-CD79B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products