Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iladatuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Iladatuzumab ELISA Kit

Iladatuzumab ELISA Kit

Product name Iladatuzumab ELISA Kit
Uniprot ID P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX228
Note For research use only.
Sample type Plasma, Serum
Target Iladatuzumab
Immunogen Iladatuzumab

Introduction to Iladatuzumab ELISA Kit

The Iladatuzumab ELISA Kit is a specialized diagnostic tool used in the field of immunology to detect and quantify the presence of Iladatuzumab, a monoclonal antibody, in biological samples. This kit is designed to provide accurate and reliable results for researchers and clinicians studying the structure, activity, and application of Iladatuzumab in various therapeutic settings.

Structure of Iladatuzumab

Iladatuzumab is a humanized IgG1 monoclonal antibody that specifically targets CD44, a cell surface glycoprotein involved in cell adhesion and migration. It is composed of two heavy chains and two light chains, each containing a variable region responsible for antigen binding and a constant region that determines the antibody’s effector functions.

The variable region of Iladatuzumab is engineered to bind with high affinity and specificity to CD44, making it a potent therapeutic agent. The constant region, on the other hand, is responsible for activating the immune system and mediating the antibody’s effector functions, such as antibody-dependent cellular cytotoxicity and complement-dependent cytotoxicity.

Activity of Iladatuzumab

Iladatuzumab has been shown to have multiple modes of action, making it a promising therapeutic target for various diseases. Its primary mechanism of action is through the blockade of CD44, which inhibits cell adhesion and migration, leading to the suppression of tumor growth and metastasis.

Additionally, Iladatuzumab has been found to induce apoptosis, or programmed cell death, in cancer cells expressing high levels of CD44. This further contributes to its anti-tumor activity and makes it an attractive candidate for cancer treatment.

Moreover, Iladatuzumab has been shown to modulate the immune system by promoting the activation and proliferation of immune cells, such as natural killer cells and T cells. This can enhance the body’s natural defense against cancer and other diseases.

Application of Iladatuzumab ELISA Kit

The Iladatuzumab ELISA Kit is a valuable tool for researchers and clinicians studying the use of Iladatuzumab in various therapeutic applications. It allows for the accurate and sensitive detection of Iladatuzumab in biological samples, such as serum, plasma, and tissue lysates.

One of the primary applications of the Iladatuzumab ELISA Kit is in the development and monitoring of Iladatuzumab-based therapies for cancer. By quantifying the levels of Iladatuzumab in patient samples, researchers can assess the efficacy of the treatment and make informed decisions about dosage and treatment duration.

Furthermore, the Iladatuzumab ELISA Kit can also be used in preclinical studies to evaluate the pharmacokinetics and pharmacodynamics of Iladatuzumab. This information is crucial in the development of new therapeutic strategies and can aid in the optimization of treatment protocols.

Aside from

cancer, Iladatuzumab has also shown potential in other diseases, such as autoimmune disorders and inflammatory conditions. The Iladatuzumab ELISA Kit can be used to measure the levels of Iladatuzumab in these diseases and assess its therapeutic potential.

Conclusion

The Iladatuzumab ELISA Kit is a valuable tool for researchers and clinicians studying the structure, activity, and application of Iladatuzumab. Its accurate and sensitive detection of Iladatuzumab in biological samples makes it an essential component in the development and monitoring of Iladatuzumab-based therapies. With its potential in various therapeutic settings, Iladatuzumab continues to be a promising therapeutic target in the field of immunology.

Iladatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Iladatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products