Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Polatuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Polatuzumab ELISA Kit

Polatuzumab ELISA Kit

Product name Polatuzumab ELISA Kit
Uniprot ID P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX229
Note For research use only.
Sample type Plasma, Serum
Target Polatuzumab
Immunogen Polatuzumab

Introduction to Polatuzumab ELISA Kit

Polatuzumab is a novel antibody therapeutic that has shown promising results in the treatment of various types of cancer. It specifically targets the CD79b protein, which is overexpressed in many B-cell malignancies. To effectively monitor the levels of Polatuzumab in patient samples, a Polatuzumab ELISA Kit has been developed. This kit is a valuable tool for researchers and clinicians to measure the levels of Polatuzumab and its therapeutic activity in patients undergoing treatment.

Structure of Polatuzumab ELISA Kit

The Polatuzumab ELISA Kit is a sandwich enzyme-linked immunosorbent assay (ELISA) that utilizes specific antibodies to detect and quantify Polatuzumab in biological samples. The kit contains all the necessary reagents and materials for the assay, including pre-coated plates, buffers, standards, and detection antibodies.

The assay works by first binding the Polatuzumab in the sample to the pre-coated plates. The detection antibody is then added, which binds to the other end of the Polatuzumab, creating a sandwich complex. This complex is then detected by an enzyme-conjugated secondary antibody, which produces a colorimetric signal that is directly proportional to the amount of Polatuzumab present in the sample.

Activity of Polatuzumab ELISA Kit

The Polatuzumab ELISA Kit has a high sensitivity and specificity, making it a reliable tool for measuring Polatuzumab levels in patient samples. It has a detection range of 0.1-10 ng/mL, allowing for accurate quantification of Polatuzumab even at low concentrations. The kit also has a short incubation time of only 2 hours, making it a convenient and efficient option for high-throughput screening.

Furthermore, the Polatuzumab ELISA Kit has been validated for use with various sample types, including serum, plasma, and cell culture supernatant. This allows for flexibility in sample collection and analysis, making it suitable for both preclinical and clinical studies.

Application of Polatuzumab ELISA Kit

The primary application of the Polatuzumab ELISA Kit is in monitoring the levels of Polatuzumab in patient samples during clinical trials and treatment. This allows for the assessment of drug efficacy and pharmacokinetics, as well as the identification of potential adverse effects.

Additionally, the Polatuzumab ELISA Kit can also be used for research purposes, such as in the development of Polatuzumab-based therapies and the study of Polatuzumab’s mechanism of action. It can also be used to screen for potential biomarkers that may predict response to Polatuzumab treatment.

Conclusion

In summary, the Polatuzumab ELISA Kit is a valuable tool for the measurement and monitoring of Polatuzumab levels in patient samples. Its high sensitivity, specificity, and versatility make it a reliable and convenient option for researchers and clinicians studying this promising antibody therapeutic. With its use, we can gain a better understanding of the activity and efficacy of Polatuzumab in the treatment of various types of cancer, ultimately leading to improved patient outcomes.

Polatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Polatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products