Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pasotuxizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Pasotuxizumab ELISA Kit

Pasotuxizumab ELISA Kit

Product name Pasotuxizumab ELISA Kit
Uniprot ID Q04609 & P07766
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX238
Note For research use only.
Sample type Plasma, Serum
Target Pasotuxizumab
Immunogen Pasotuxizumab

Pasotuxizumab ELISA Kit: A Powerful Tool for Detecting and Studying Antibodies Against

Therapeutic Target Introduction

Pasotuxizumab is a novel monoclonal antibody that has shown promising results in the treatment of various cancers. As with any therapeutic antibody, it is important to have a reliable and sensitive method for detecting and quantifying its presence in biological samples. This is where the Pasotuxizumab ELISA kit comes in.

Structure of Pasotuxizumab

Pasotuxizumab is a fully human IgG1 monoclonal antibody that specifically targets a protein known as CD40. This protein is found on the surface of immune cells and is involved in the activation and regulation of immune responses. Pasotuxizumab binds to CD40 with high affinity and has been shown to induce potent anti-tumor activity in preclinical studies.

The Pasotuxizumab ELISA kit utilizes a sandwich ELISA format, where the antibody is immobilized on a solid surface and used to capture the target protein. The captured CD40 is then detected using a secondary antibody that is conjugated to an enzyme, resulting in a colorimetric readout that is directly proportional to the amount of Pasotuxizumab present in the sample.

Activity of Pasotuxizumab

The primary activity of Pasotuxizumab is its ability to bind to CD40 and block its interaction with other proteins, leading to inhibition of downstream signaling pathways involved in tumor growth and survival. This results in the activation of immune cells and the induction of anti-tumor immune responses.

The Pasotuxizumab ELISA kit allows for the measurement of Pasotuxizumab levels in biological samples, such as serum or plasma, which can provide valuable information about the drug’s pharmacokinetics and pharmacodynamics. It can also be used to monitor the development of anti-drug antibodies, which can impact the efficacy and safety of Pasotuxizumab treatment.

Application of Pasotuxizumab ELISA Kit

The Pasotuxizumab ELISA kit has a wide range of applications in both research and clinical settings. In research, it can be used to study the pharmacokinetics and pharmacodynamics of Pasotuxizumab, as well as its mechanism of action. It can also be used to screen for potential drug interactions and to evaluate the immunogenicity of Pasotuxizumab.

In clinical settings, the Pasotuxizumab ELISA kit can be used for patient monitoring, to assess the response to treatment and to detect the development of anti-drug antibodies. This information can help guide treatment decisions and improve patient outcomes.

Conclusion

In summary, the Pasotuxizumab ELISA kit is a powerful tool for detecting and studying antibodies against the therapeutic target CD40. Its reliable and sensitive detection method makes it an essential tool for research and clinical applications. With the promising results of Pasotuxizumab in cancer treatment, the Pasotuxizumab ELISA kit will continue to play a crucial role in the development and monitoring of this novel therapeutic antibody.

Pasotuxizumab ELISA Kit

There are no reviews yet.

Be the first to review “Pasotuxizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products