Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rafivirumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Rafivirumab ELISA Kit

Rafivirumab ELISA Kit

Product name Rafivirumab ELISA Kit
Uniprot ID O92284
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX288
Note For research use only.
Sample type Plasma, Serum
Target Rafivirumab
Immunogen Rafivirumab

Rafivirumab ELISA Kit: Structure, Activity and Application Rafivirumab ELISA Kit: Structure, Activity and Application Introduction

Rafivirumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection of Rafivirumab, a monoclonal antibody that targets the protein receptor tyrosine kinase-like orphan receptor 1 (ROR1). This kit is designed for research purposes and is not intended for diagnostic use in humans.

Structure of Rafivirumab

Rafivirumab is a humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, with each chain containing variable and constant regions. The variable regions are responsible for binding to the specific target, while the constant regions provide structural stability and effector functions.

Activity of Rafivirumab

Rafivirumab binds with high affinity to ROR1, a transmembrane protein that is overexpressed in a variety of cancers, including breast, lung, and pancreatic cancer. This binding prevents the activation of downstream signaling pathways involved in tumor growth and survival, ultimately leading to cell death.

Additionally, Rafivirumab can also mediate antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against ROR1-expressing cancer cells. This further enhances its anti-tumor activity by recruiting immune cells to attack and destroy cancer cells.

Application of Rafivirumab ELISA Kit

The Rafivirumab ELISA Kit is a valuable tool in cancer research, particularly in the development and evaluation of Rafivirumab-based therapies. This kit allows for the quantitative measurement of Rafivirumab levels in various biological samples, such as serum, plasma, and cell culture supernatants.

One of the main applications of this kit is in the monitoring of Rafivirumab levels in patients undergoing treatment with this antibody. By measuring the levels of Rafivirumab in the blood, researchers can assess the drug’s pharmacokinetics and determine the optimal dose for effective treatment.

Moreover, the Rafivirumab ELISA Kit can also be used to screen for ROR1 expression in cancer cells and tissues. This information can aid in patient selection for Rafivirumab therapy, as well as in the identification of potential resistance mechanisms.

Conclusion

The Rafivirumab ELISA Kit is a powerful tool in the field of cancer research, providing a quantitative and sensitive method for the detection of Rafivirumab. Its ability to measure drug levels and screen for ROR1 expression makes it an essential tool in the development and evaluation of Rafivirumab-based therapies. With its high specificity and sensitivity, this kit holds great promise in the fight against ROR1-expressing cancers.

Rafivirumab ELISA Kit

There are no reviews yet.

Be the first to review “Rafivirumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products