Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rafivirumab Biosimilar – Anti-RV mAb – Research Grade

  • PX-TA1065-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade

Product name Rafivirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-37-2
Species Homo sapiens
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Rafivirumab,CR57,RV,anti-RV
Reference PX-TA1065
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Rafivirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-37-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Rafivirumab,CR57,RV,anti-RV
Reference PX-TA1065
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1065-50
Uniprot ID O92284
Source CAS 944548-37-2
Species Homo sapiens
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rafivirumab,CR57,RV,anti-RV
Reference PX-TA1065
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

The Structure of Rafivirumab Biosimilar – Anti-RV mAb

Rafivirumab Biosimilar, also known as Anti-RV mAb, is a monoclonal antibody (mAb) that specifically targets the respiratory syncytial virus (RSV). It is a biosimilar version of the original Rafivirumab antibody, which was developed by the biopharmaceutical company Regeneron and approved by the FDA for the treatment of RSV infections in infants and young children.

The structure of Rafivirumab Biosimilar is similar to that of the original antibody, with a few minor modifications. It is a Y-shaped protein molecule consisting of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains are made up of four constant regions and one variable region, while the light chains have two constant regions and one variable region.

The variable regions of the antibody are responsible for its specificity and binding to the RSV virus. They contain a unique sequence of amino acids that recognize and bind to a specific target on the surface of the virus. This target is the fusion protein, which is essential for the virus to enter and infect host cells.

The Activity of Rafivirumab Biosimilar – Anti-RV mAb

The primary activity of Rafivirumab Biosimilar is its ability to neutralize the RSV virus. When the antibody binds to the fusion protein on the surface of the virus, it prevents the virus from entering and infecting host cells. This neutralization of the virus prevents the spread of infection and allows the body’s immune system to clear the virus.

In addition to neutralization, Rafivirumab Biosimilar also has other activities that contribute to its effectiveness as a therapeutic agent. It can activate the complement system, a group of proteins that work together to destroy pathogens. This can enhance the neutralization of the virus and lead to its clearance from the body.

Furthermore, Rafivirumab Biosimilar can also recruit other immune cells, such as natural killer cells, to the site of infection. These cells can directly kill infected cells and further aid in the clearance of the virus.

Application of Rafivirumab Biosimilar – Anti-RV mAb

Rafivirumab Biosimilar is primarily used as a therapeutic agent for the treatment of RSV infections. RSV is a common respiratory virus that can cause severe respiratory illness, especially in infants and young children. It is also a leading cause of hospitalizations in this age group.

Rafivirumab Biosimilar is administered through intravenous infusion, usually in a hospital or clinical setting. It is used for the treatment of RSV infections in infants and young children who are at high risk of severe illness, such as premature infants and those with underlying medical conditions.

In addition to its therapeutic application, Rafivirumab Biosimilar is also used in research and development of new treatments for RSV. Its structure and activity make it a valuable tool for studying the virus and its interactions with the immune system. It can also be used as a positive control in assays and experiments to test the efficacy of new anti-RSV therapies.

Conclusion

Rafivirumab Biosimilar – Anti-RV mAb is a monoclonal antibody with a specific structure and activity that make it an effective therapeutic agent for the treatment of RSV infections. Its ability to neutralize the virus and activate the immune system contribute to its effectiveness in preventing the spread of infection and clearing the virus from the body. In addition to its therapeutic application, it also has uses in research and development, making it a valuable tool in the fight against RSV.

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Immobilized Rabies virus/RABV G/Glycoprotein recombinant protein (cat. No.PX-P6266) at 0.5µg/mL (100µL/well) can bind Rafivirumab Biosimilar - Anti-RV mAb - Research Grade (cat. No.PX-TA1065) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 8.196M.

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade

There are no reviews yet.

Be the first to review “Rafivirumab Biosimilar – Anti-RV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products