Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Intra Acrosomal,SP-10 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P26436
Molecular weight:
29.7kDa

Original price was: $1,768.00.Current price is: $1,449.00.

1MG 18% OFF + 1449 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Intra Acrosomal,SP-10 recombinant protein

Product name PX-P4029-1MG
Uniprot ID P26436
Uniprot link http://www.uniprot.org/uniprot/P26436
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Molecular weight 29.7kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms Acrosomal protein SP 10, Acrosomal protein SP-10, Acrosomal vesicle protein 1, ACRV1, ASPX_HUMAN, D11S4365, Msa63, SP 10, Sp10, SPACA2, Sperm protein 10
Reference PX-P4029
Note For research use only.
Molecular Constructor
Full-length Yes
Product name Human Intra Acrosomal,SP-10 recombinant protein
Uniprot ID P26436
Uniprot link http://www.uniprot.org/uniprot/P26436
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Molecular weight 29.7kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms Acrosomal protein SP 10, Acrosomal protein SP-10, Acrosomal vesicle protein 1, ACRV1, ASPX_HUMAN, D11S4365, Msa63, SP 10, Sp10, SPACA2, Sperm protein 10
Reference PX-P4029
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Intra Acrosomal,SP-10 recombinant protein
Uniprot ID P26436
Uniprot link http://www.uniprot.org/uniprot/P26436
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Molecular weight 29.7kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms Acrosomal protein SP 10, Acrosomal protein SP-10, Acrosomal vesicle protein 1, ACRV1, ASPX_HUMAN, D11S4365, Msa63, SP 10, Sp10, SPACA2, Sperm protein 10
Reference PX-P4029
Note For research use only
Molecular Constructor
Full-length Yes

Human Intra Acrosomal,SP-10 recombinant protein

There are no reviews yet.

Be the first to review “Human Intra Acrosomal,SP-10 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products