Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Chuck Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O15111
Molecular weight:
22,03 kDa

Original price was: $364.00.Current price is: $308.00.

50ug 15% OFF + 308 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Chuck Recombinant Protein

Product name Human Chuck Recombinant Protein
Uniprot ID O15111
Uniprot link http://www.uniprot.org/uniprot/O15111
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMT SAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFA SRSLSDCVNYIVQDSKIQLPIIQLRRSHNHRHKH
Molecular weight 22,03 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, Urea 8M, pH6-8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAC50713.1
Spec:Entrez GeneID 1147
Spec:NCBI Gene Aliases TCF16, IKK1, IKBKA, IKK-alpha, NFKBIKA, IKKA
Spec:SwissProtID O15111
NCBI Reference AAC50713.1
Aliases /Synonyms Chuck, Conserved helix-loop-helix ubiquitous kinase1, inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK alpha)
Reference PX-P1080
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Chuck Recombinant Protein
Uniprot ID O15111
Uniprot link http://www.uniprot.org/uniprot/O15111
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMT SAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFA SRSLSDCVNYIVQDSKIQLPIIQLRRSHNHRHKH
Molecular weight 22,03 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, Urea 8M, pH6-8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAC50713.1
Spec:Entrez GeneID 1147
Spec:NCBI Gene Aliases TCF16, IKK1, IKBKA, IKK-alpha, NFKBIKA, IKKA
Spec:SwissProtID O15111
NCBI Reference AAC50713.1
Aliases /Synonyms Chuck, Conserved helix-loop-helix ubiquitous kinase1, inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK alpha)
Reference PX-P1080
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1080-1MG
Uniprot ID O15111
Uniprot link http://www.uniprot.org/uniprot/O15111
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMT SAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFA SRSLSDCVNYIVQDSKIQLPIIQLRRSHNHRHKH
Molecular weight 22,03 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, Urea 8M, pH6-8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAC50713.1
Spec:Entrez GeneID 1147
Spec:NCBI Gene Aliases TCF16, IKK1, IKBKA, IKK-alpha, NFKBIKA, IKKA
Spec:SwissProtID O15111
NCBI Reference AAC50713.1
Aliases /Synonyms Chuck, Conserved helix-loop-helix ubiquitous kinase1, inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK alpha)
Reference PX-P1080
Note For research use only
Molecular Constructor
Partial Yes

Human Chuck Recombinant Protein

There are no reviews yet.

Be the first to review “Human Chuck Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products