Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Beta-nerve growth factor recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01138
Molecular weight:
53.31kDa

Original price was: $315.00.Current price is: $250.00.

50ug 21% OFF + 250 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Beta-nerve growth factor recombinant protein

Product name Human Beta-nerve Growth Factor proteins recombinant protein
Uniprot ID P01138
Uniprot link http://www.uniprot.org/uniprot/P01138
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Molecular weight 53.31kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 0.1M Tris-HCl, 0.1M Glycine, pH=7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms NGF, NGFB, Beta-NGF, HSAN5, NGF-B, Beta-Nerve Growth Factor proteins
Reference PX-P4027
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Beta-nerve Growth Factor proteins recombinant protein
Uniprot ID P01138
Uniprot link http://www.uniprot.org/uniprot/P01138
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Molecular weight 53.31kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 0.1M Tris-HCl, 0.1M Glycine, pH=7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms NGF, NGFB, Beta-NGF, HSAN5, NGF-B, Beta-Nerve Growth Factor proteins
Reference PX-P4027
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P4027-1MG
Uniprot ID P01138
Uniprot link http://www.uniprot.org/uniprot/P01138
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Molecular weight 53.31kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 0.1M Tris-HCl, 0.1M Glycine, pH=7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms NGF, NGFB, Beta-NGF, HSAN5, NGF-B, Beta-Nerve Growth Factor proteins
Reference PX-P4027
Note For research use only
Molecular Constructor
Full-length Yes

Human Beta-nerve growth factor recombinant protein

There are no reviews yet.

Be the first to review “Human Beta-nerve growth factor recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products