Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tanezumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Tanezumab ELISA Kit

Tanezumab ELISA Kit

Product name Tanezumab ELISA Kit
Uniprot ID P01138
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX126
Note For research use only.
Sample type Plasma, Serum
Target Tanezumab
Immunogen Tanezumab

Introduction

Tanezumab is a humanized monoclonal antibody that has been developed as a therapeutic agent for the treatment of chronic pain. It specifically targets nerve growth factor (NGF), a protein that plays a crucial role in pain signaling. The Tanezumab ELISA Kit is a highly sensitive and specific assay that is used for the quantitative detection of Tanezumab in biological samples. In this article, we will discuss the structure, activity, and application of the Tanezumab ELISA Kit.

Structure of Tanezumab

Tanezumab is a recombinant humanized IgG2 monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains are made up of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains consist of one constant domain (CL) and one variable domain (VL). The variable domains of both heavy and light chains are responsible for the specificity of Tanezumab towards its target, NGF.

The structure of Tanezumab is similar to that of other humanized antibodies, with the exception of the Fc region. Tanezumab has a modified Fc region that does not bind to Fc receptors, which reduces the potential for antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). This modification allows for a longer half-life of Tanezumab in the body, making it a more effective therapeutic agent.

Activity of Tanezumab

The main activity of Tanezumab is the inhibition of NGF signaling. NGF is a neurotrophin that plays a key role in the development and maintenance of sensory and sympathetic neurons. It is also involved in the transmission of pain signals from the periphery to the central nervous system. Tanezumab binds to NGF with high affinity, preventing it from interacting with its receptors, TrkA and p75. This results in the inhibition of NGF signaling, leading to a reduction in pain sensation.

Tanezumab has been shown to be effective in the treatment of various types of chronic pain, including osteoarthritis, chronic low back pain, and cancer pain. It has also been found to have a synergistic effect when used in combination with other analgesic drugs, such as opioids. This makes Tanezumab a promising therapeutic option for patients who do not respond well to traditional pain management strategies.

Application of Tanezumab ELISA Kit

The Tanezumab ELISA Kit is a valuable tool for the quantitative detection of Tanezumab in biological samples. It is a highly sensitive and specific assay that can detect Tanezumab at levels as low as 10 ng/mL. The kit is designed to be user-friendly and can be used in a variety of laboratory settings.

The Tanezumab ELISA Kit has several applications, including pharmacokinetic studies, drug development, and clinical trials. It can be used to measure the levels of Tanezumab in serum, plasma, and other biological fluids, providing valuable information on the pharmacokinetics of the drug. This information can help researchers and clinicians to optimize dosing regimens and monitor the effectiveness of Tanezumab treatment.

The Tanezumab ELISA Kit can also be used in drug development to assess the stability and purity of Tanezumab preparations. It can detect any potential impurities or degradation products, ensuring the safety and efficacy of the drug. Additionally, the kit can be used in clinical trials to monitor the levels of Tanezumab in patients and evaluate its therapeutic efficacy.

Conclusion

The Tanezumab ELISA Kit is a valuable tool for the quantitative detection of Tane

Tanezumab ELISA Kit

There are no reviews yet.

Be the first to review “Tanezumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products