Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tanezumab Biosimilar – Anti-IGHE mAb – Research Grade

  • PX-TA1164-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade

Product name Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade
Uniprot ID P01138
Source CAS 880266-57-9
Species Humanized
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tanezumab,PF-04383119,RN624,IGHE,anti-IGHE
Reference PX-TA1164
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade
Uniprot ID P01138
Source CAS 880266-57-9
Species Humanized
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tanezumab,PF-04383119,RN624,IGHE,anti-IGHE
Reference PX-TA1164
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1164-50
Uniprot ID P01138
Source CAS 880266-57-9
Species Humanized
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tanezumab,PF-04383119,RN624,IGHE,anti-IGHE
Reference PX-TA1164
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction

Tanezumab is a biosimilar of the anti-IGHE monoclonal antibody (mAb) that has shown promising results in the treatment of various inflammatory conditions. It is a research grade antibody that specifically targets the IGHE protein, making it a valuable tool for studying the role of this protein in various diseases.

Structure of Tanezumab Biosimilar

Tanezumab Biosimilar is a recombinant humanized IgG1 mAb that has been engineered to have a high affinity for the IGHE protein. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a unique binding site that specifically recognizes and binds to the IGHE protein, preventing its interaction with other molecules and inhibiting its function.

Activity of Tanezumab Biosimilar

The primary activity of Tanezumab Biosimilar is its ability to block the function of the IGHE protein. IGHE is a key mediator of inflammation and is involved in various immune responses. By binding to IGHE, Tanezumab Biosimilar prevents it from activating immune cells and triggering inflammatory responses. This leads to a decrease in the production of inflammatory cytokines and a reduction in the overall inflammatory response.

In addition to its anti-inflammatory activity, Tanezumab Biosimilar also has other potential activities. Studies have shown that it may have a role in modulating the function of immune cells, such as B cells and T cells, and may also have an impact on the production of antibodies. These additional activities are still being investigated and may have implications for the use of Tanezumab Biosimilar in the treatment of various diseases.

Application of Tanezumab Biosimilar

Tanezumab Biosimilar has shown promising results in preclinical studies for the treatment of various inflammatory conditions, including asthma, rheumatoid arthritis, and psoriasis. It has also been investigated for its potential use in allergic diseases, such as allergic rhinitis and atopic dermatitis. The unique specificity of Tanezumab Biosimilar for the IGHE protein makes it a valuable tool for studying the role of this protein in these diseases, as well as for identifying potential new therapeutic targets.

Furthermore, Tanezumab Biosimilar has also been investigated for its potential use in cancer therapy. IGHE has been shown to play a role in tumor growth and progression, and targeting this protein with Tanezumab Biosimilar may have anti-tumor effects. Clinical trials are currently underway to evaluate the efficacy and safety of Tanezumab Biosimilar in cancer treatment.

Conclusion

Tanezumab Biosimilar is a research grade anti-IGHE mAb with a unique structure and activity. Its ability to specifically target the IGHE protein makes it a valuable tool for studying the role of this protein in various diseases, as well as for potential therapeutic use. With promising results in preclinical studies and ongoing clinical trials, Tanezumab Biosimilar has the potential to become a valuable treatment option for a range of inflammatory conditions and cancer.

Keywords

Antibody, therapeutic target, Tanezumab Biosimilar, anti-IGHE mAb, structure, activity, application, inflammation, immune response, cancer therapy.

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Immobilized beta-nerve growth factor(NGF) (cat. No.PX-P4646) at 0.5µg/mL (100µL/well) can bind Tanezumab Biosimilar - Anti-IGHE mAb (cat. No.PX-TA1164) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 229.8M.

Tanezumab Biosimilar - Anti-IGHE mAb - Research Grade

There are no reviews yet.

Be the first to review “Tanezumab Biosimilar – Anti-IGHE mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products