Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Relfovetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Relfovetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

Product name Relfovetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 2171034-70-9
Species Felinized
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Relfovetmab ,ZTS-00084768,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1569
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Relfovetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 2171034-70-9
Species Felinized
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Relfovetmab ,ZTS-00084768,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1569
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1569-50
Uniprot ID Q6ZY27
Source CAS 2171034-70-9
Species Felinized
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Relfovetmab ,ZTS-00084768,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1569
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Relfovetmab Biosimilar, also known as Anti-NGF or NGFB mAb, is a research grade monoclonal antibody that targets the nerve growth factor (NGF). NGF is a protein that plays a crucial role in the development and maintenance of the nervous system. Relfovetmab Biosimilar is a biosimilar version of the original monoclonal antibody, designed to have similar structure, activity and application, but at a more affordable cost.

Structure of Relfovetmab Biosimilar

Relfovetmab Biosimilar is a recombinant humanized monoclonal antibody, meaning that it is produced in a laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of around 20 days in the body.

The antigen-binding region of Relfovetmab Biosimilar is made up of variable regions of the heavy and light chains, which are responsible for binding to the NGF protein. The constant regions of the antibody determine its effector functions, such as activation of the immune system and clearance of the target protein.

Mechanism of Action

Relfovetmab Biosimilar works by binding to NGF and preventing it from interacting with its receptors, TrkA and p75. This inhibits the downstream signaling pathways involved in pain transmission and inflammation, making it a potential therapeutic target for chronic pain conditions such as osteoarthritis and neuropathic pain.

In addition, Relfovetmab Biosimilar has been shown to induce the internalization and degradation of NGF receptors, leading to a decrease in the number of receptors available for binding to NGF. This further reduces the activity of NGF and its effects on pain and inflammation.

Applications of Relfovetmab Biosimilar

Relfovetmab Biosimilar has potential applications in the treatment of various chronic pain conditions, including osteoarthritis, diabetic neuropathy, and cancer pain. It is currently being evaluated in clinical trials for its safety and efficacy in these indications.

In addition, Relfovetmab Biosimilar can also be used in research settings to study the role of NGF in various diseases and to develop new therapies targeting the NGF pathway. Its low cost and availability in large quantities make it a valuable tool for researchers.

Conclusion

Relfovetmab Biosimilar is a research grade monoclonal antibody that targets the nerve growth factor, a protein involved in pain and inflammation. Its structure and mechanism of action are similar to the original monoclonal antibody, making it a cost-effective alternative for research and potential therapeutic use. With ongoing clinical trials and potential applications in various chronic pain conditions, Relfovetmab Biosimilar holds promise as a valuable tool in the fight against pain and inflammation.

Keywords

Antibody, therapeutic target, Relfovetmab Biosimilar, Anti-NGF, NGFB mAb, nerve growth factor, chronic pain, inflammation, osteoarthritis, neuropathic pain, TrkA, p75, clinical trials, research.

SDS-PAGE for Relfovetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

SDS-PAGE for Relfovetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

Relfovetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Relfovetmab  Biosimilar - Anti-NGF, NGFB mAb - Research Grade

There are no reviews yet.

Be the first to review “Relfovetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products